PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g00540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family TALE
Protein Properties Length: 587aa    MW: 66553.3 Da    PI: 7.1532
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g00540genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.4e-093914281954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  Tp7g00540 391 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 428
                554459******************************88 PP

2BELL103.21.8e-33249320172
       BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                e++elqk+kakLl +lee+++rY +y+eq++  +++Fea++g+g+a++Yt+lA++a+SrhFrcLkd +++qi
  Tp7g00540 249 EFMELQKRKAKLLAMLEELKRRYGHYREQMRLAAGAFEAAVGIGAAEMYTALASRAMSRHFRCLKDGLVGQI 320
                679*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075263.3E-41177316IPR006563POX domain
SMARTSM005749.7E-65183318IPR006563POX domain
PROSITE profilePS5007112.017369432IPR001356Homeobox domain
CDDcd000861.59E-10372433No hitNo description
SMARTSM003895.6E-9372436IPR001356Homeobox domain
SuperFamilySSF466892.99E-17373439IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.3E-28375439IPR009057Homeodomain-like
PfamPF059207.7E-18389428IPR008422Homeobox KN domain
CDDcd001020.00354465540No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MINQIPGFDG TNQNPNVHHH QQQHHYNHQI FGSNSNMGMM IDFSKQHEIR MTSGMDHHHH  60
HHHQTSGGTD QNQLLEDSSS SMRLCNVNNN FSSEVNDERP PQRPSQGLSL SLSSSNPTSI  120
SLQSFDLRPQ QQQLQGYSGK STHHQNLPHS QMMLMMMNSQ QQNNTSNLHH HHHQFQIGSS  180
KFLSPAQELL SDFCSLGVKE SDDEVMMMKH KRKQKGKQQE EWDTSNNDQQ DQSATTSSKK  240
HVPPLHSLEF MELQKRKAKL LAMLEELKRR YGHYREQMRL AAGAFEAAVG IGAAEMYTAL  300
ASRAMSRHFR CLKDGLVGQI QATSQALGER DDDNRGVSIA ARGETPRLRL LDQALRQQKS  360
YRQMSLVEAH PWRPQRGLPE RAVTTLRAWL FEHFLHPYPS DVDKHILARQ TGLSRSQVSN  420
WFINARVRLW KPMIEEMYCE ETRGEEQQME ITNPMFIDTK PDPNQIMRVE PESLSAIVTK  480
TGHKDNSNQQ GTVSFGSTFD FSSYGGNQAV TYTGEGGTRD VSLTLGLQNG GVSLALSPVT  540
AQVGPLYYGR DHIEGSVQYQ PSMLDDDQAQ NLPYRNLMGA QLLHDMV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-15378436563Homeobox protein Meis2
3k2a_B2e-15378436563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3528660.0AK352866.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-17-O06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013637027.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388970.0BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLA0A0D3C0G20.0A0A0D3C0G2_BRAOL; Uncharacterized protein
STRINGBra025497.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58662639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.10.0TALE family protein