PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g00470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WRKY
Protein Properties Length: 178aa    MW: 20715.3 Da    PI: 7.9916
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g00470genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.97.8e-3296154159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK+vk++ +prsYYrCt+++C+vkk+v+r a+d +vv++tYeg Hnh+
  Tp7g00470  96 LDDGYRWRKYGQKSVKNNGHPRSYYRCTYHTCNVKKQVQRLAKDSNVVVTTYEGIHNHP 154
                59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.6E-3283154IPR003657WRKY domain
SuperFamilySSF1182904.18E-2888155IPR003657WRKY domain
PROSITE profilePS5081128.75991156IPR003657WRKY domain
SMARTSM007741.8E-3696155IPR003657WRKY domain
PfamPF031061.6E-2597154IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MERQDIDHML SLDVENNDVN TFSSFVDKTL MMMPPLTYSG EVEPSSSSWC PTSFHVPTQP  60
LENDQIGDEG KKKEKEKRSR KVPRIAFHTR SDDDVLDDGY RWRKYGQKSV KNNGHPRSYY  120
RCTYHTCNVK KQVQRLAKDS NVVVTTYEGI HNHPCEKLME TLNPLLRQLQ FLSSFSNL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-2586153774Probable WRKY transcription factor 4
2lex_A5e-2586153774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00539DAPTransfer from AT5G41570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300420.0KF430042.1 Brassica rapa WRKY transcription factor 24 (WRKY24) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013635201.11e-111PREDICTED: probable WRKY transcription factor 24
RefseqXP_013743457.11e-111PREDICTED: probable WRKY transcription factor 24
RefseqXP_013746877.11e-111PREDICTED: probable WRKY transcription factor 24
SwissprotQ9FFS31e-104WRK24_ARATH; Probable WRKY transcription factor 24
TrEMBLV5RH051e-113V5RH05_BRACM; WRKY transcription factor 24
STRINGBra025490.1-P1e-110(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41570.14e-88WRKY DNA-binding protein 24