PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp6g37130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WOX
Protein Properties Length: 188aa    MW: 21330.1 Da    PI: 10.1968
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp6g37130genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.43.3e-202687157
               TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
               ++ R+++t eq+++L +lF+   r+ps++++++++++l    +++ ++V++WFqN++a+e++
  Tp6g37130 26 KCGRWNPTVEQVKVLTDLFKAgLRTPSTDQIQKISTELsfygKIESKNVFYWFQNHKARERQ 87
               568*****************99**************************************97 PP

2Wus_type_Homeobox112.91.6e-362689265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ++ RW+Pt eQ+k+L++l+k+GlrtP++++iq+i++eL+ yGkie+kNVfyWFQN+kaRerqk+
          Tp6g37130 26 KCGRWNPTVEQVKVLTDLFKAGLRTPSTDQIQKISTELSFYGKIESKNVFYWFQNHKARERQKR 89
                       678***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.6252388IPR001356Homeobox domain
SMARTSM003894.7E-42592IPR001356Homeobox domain
PfamPF000462.9E-172787IPR001356Homeobox domain
SuperFamilySSF466894.28E-112891IPR009057Homeodomain-like
CDDcd000868.40E-52989No hitNo description
Gene3DG3DSA:1.10.10.608.6E-82987IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MSSGGFSTKA RGLGNSNVGG VGTGTKCGRW NPTVEQVKVL TDLFKAGLRT PSTDQIQKIS  60
TELSFYGKIE SKNVFYWFQN HKARERQKRR KISTVDFDHR QDTNLTLPRQ HNPRHHQPPP  120
KACEEKEKVI ETLQLFPLSK VERARANITA ATHNEYIRDQ ANTTVFSTYS SCGAEMEHPP  180
LDLRLSFL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009122174.11e-112PREDICTED: WUSCHEL-related homeobox 7
RefseqXP_013610643.11e-112PREDICTED: WUSCHEL-related homeobox 7
RefseqXP_013715481.11e-112PREDICTED: WUSCHEL-related homeobox 7-like
SwissprotQ8H1D23e-78WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBLA0A078ECT31e-112A0A078ECT3_BRANA; BnaC09g49730D protein
TrEMBLA0A0D3EHJ71e-112A0A0D3EHJ7_BRAOL; Uncharacterized protein
TrEMBLM4CY351e-112M4CY35_BRARP; Uncharacterized protein
STRINGBra009132.1-P1e-112(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40142857
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.11e-72WUSCHEL related homeobox 5