PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp6g34620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family TCP
Protein Properties Length: 240aa    MW: 24687.7 Da    PI: 10.4572
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp6g34620genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP123.42.6e-3827106282
        TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssa 82 
                a+kk +++++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++as++ ++s s s+
  Tp6g34620  27 AVKKPPSKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFS-TASLSTSS 106
                79**************************************************************99999777.22222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.5E-3233107IPR005333Transcription factor, TCP
PROSITE profilePS5136928.2093387IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042752Biological Processregulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MANNDGAVTN GVIVEQTSAI NKGTLNAVKK PPSKDRHSKV DGRGRRIRMP IICAARVFQL  60
TRELGHKSDG QTIEWLLRQA EPSIIAATGT GTTPASFSTA SLSTSSPFTL GKRVVRAEEG  120
ESGAGGGGGL SVGPTMGTSL MSGGAGAGAG GFWAVPARSD FGQVWSFAAG APPEMLFTQQ  180
QQPATLFVRQ QQQASAAAAA MGEASAARVG NYLPGHHLNL LASLSGGTTG SGRREEEEPR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the regulation of the circadian clock. Acts as a repressor of CCA1 by binding to its promoter. No binding to the LHY promoter. {ECO:0000269|PubMed:19286557}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00499DAPTransfer from AT5G08330Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp6g34620
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4120740.0AF412074.1 Arabidopsis thaliana AT5g08330/F8L15_60 mRNA, complete cds.
GenBankAL3921740.0AL392174.1 Arabidopsis thaliana DNA chromosome 5, BAC clone F8L15 (ESSA project).
GenBankAY0726200.0AY072620.1 Arabidopsis thaliana AT5g08330/F8L15_60 mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288561.11e-129transcription factor TCP21
SwissprotQ9FTA21e-118TCP21_ARATH; Transcription factor TCP21
TrEMBLR0GX401e-127R0GX40_9BRAS; Uncharacterized protein
STRINGCagra.1365s0040.1.p1e-128(Capsella grandiflora)
STRINGXP_006288561.11e-128(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17822685
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08330.12e-83TCP family protein
Publications ? help Back to Top
  1. Wu JF, et al.
    LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
    Nat Commun, 2016. 7: p. 13181
    [PMID:27734958]
  2. Ng DW,Chen HH,Chen ZJ
    Heterologous protein-DNA interactions lead to biased allelic expression of circadian clock genes in interspecific hybrids.
    Sci Rep, 2017. 7: p. 45087
    [PMID:28345627]
  3. Lee CM, et al.
    Decoys Untangle Complicated Redundancy and Reveal Targets of Circadian Clock F-Box Proteins.
    Plant Physiol., 2018. 177(3): p. 1170-1186
    [PMID:29794020]