PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp6g32440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family TALE
Protein Properties Length: 388aa    MW: 43736.5 Da    PI: 6.4201
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp6g32440genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.68.8e-083323652154
                HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                k +yp++e++++L +++gL+ +q+ +WF N+R +
  Tp6g32440 332 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 365
                469*****************************87 PP

2ELK292.5e-10286307122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELKh+L+++Y+++++++++E++
  Tp6g32440 286 ELKHELKQGYKEKIVDIREEIL 307
                9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.0E-19121165IPR005540KNOX1
PfamPF037909.9E-18124164IPR005540KNOX1
SMARTSM012562.7E-27176232IPR005541KNOX2
PfamPF037911.4E-19182231IPR005541KNOX2
SMARTSM011886.1E-4286307IPR005539ELK domain
PfamPF037898.8E-7286307IPR005539ELK domain
PROSITE profilePS512139.969286306IPR005539ELK domain
PROSITE profilePS5007111.726306369IPR001356Homeobox domain
SMARTSM003892.4E-11308373IPR001356Homeobox domain
SuperFamilySSF466899.84E-16308373IPR009057Homeodomain-like
CDDcd000864.94E-11309370No hitNo description
Gene3DG3DSA:1.10.10.601.9E-25313370IPR009057Homeodomain-like
PfamPF059201.1E-17326365IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MSFHHNHFNH FTDQQHQPPP PPPSQQQEQH FQESTPPNWL LRSDNNFLNL HTAAASAAAT  60
SSDSPSSAAA NQWLSRSSSF LQRGGGANNN NAGSGDVIDD VTGGEESMMG EKKEAERWQN  120
ARHKAEILSH PLYEQLLSAH VACLRIATPV DQLPRIDAQL AQSQNVVAKY SSLDAAQGLI  180
SGDEKELDHF MTHYVLLLCS FKEQLQQHVR VHAMEAVMAC WEIEQSLQSF TGVSPGEGTG  240
ATMSEDEEEQ VESDAHLFDG SLDGLGFGPL VPTESERSLM ERVRQELKHE LKQGYKEKIV  300
DIREEILRKR RAGKLPGDTT SVLKAWWQSH SKWPYPTEED KARLVQETGL QLKQINNWFI  360
NQRKRNWHSN PSSSTVSKNK RRRYFAPT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12309373872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1362382RKRNWHSNPSSSTVSKNKRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533380.0AK353338.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-40-P19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006287910.10.0hypothetical protein CARUB_v10001144mg
SwissprotP480010.0KNAT4_ARATH; Homeobox protein knotted-1-like 4
TrEMBLF8SLZ80.0F8SLZ8_9BRAS; Knox-like protein 3
STRINGfgenesh2_kg.6__1072__AT5G11060.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44428158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11060.10.0KNOTTED1-like homeobox gene 4