PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp6g31310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family SRS
Protein Properties Length: 405aa    MW: 42048.9 Da    PI: 8.2271
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp6g31310genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF7022113e-651993593154
     DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkelet 102
                sgta+CqdCGnqakk+C+++RCRtCCksrgfdC+thvkstWv+aa+rrerq + +   +  ++ ++++ +k++r    ++q+++s+t++s++ ++++++t
  Tp6g31310 199 SGTATCQDCGNQAKKECKQRRCRTCCKSRGFDCSTHVKSTWVSAARRRERQVMSTGNPTAGSSLSTSSGTKKPRIV-GSQQQTTSHTSTSNT-PPQSFDT 296
                7899**********************************************99999988888888899999999987.566666777776666.6778888 PP

     DUF702 103 ss...........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                ss           +P +v+++avf+cvrv++v+dg++e+aYq++v+igGhvfkG+LydqGle 
  Tp6g31310 297 SSsrqdgggsreaWPGQVRAAAVFKCVRVTAVEDGDDEYAYQAVVKIGGHVFKGFLYDQGLEP 359
                88899*******************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051427.2E-59201358IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.5E-26203245IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.3E-30309357IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MDVKDLTGAA AVATTRRHNL PTSDSGAFTD WAATTTTTSS RATEDLSLGF NASPAVAHGD  60
LGSASAAAGV SSWPPGSSVR YGLPSSAAAT EMGMVGLRDV YLVAPAYHHQ NAGIVSGSDQ  120
INSNAAAAAL GVGVIPLLTT APSQQQNVEE TDINFFGNSR RWHNNNSNNN QTQYLHFKST  180
HQTTVASSSN NSGSGSAASG TATCQDCGNQ AKKECKQRRC RTCCKSRGFD CSTHVKSTWV  240
SAARRRERQV MSTGNPTAGS SLSTSSGTKK PRIVGSQQQT TSHTSTSNTP PQSFDTSSSR  300
QDGGGSREAW PGQVRAAAVF KCVRVTAVED GDDEYAYQAV VKIGGHVFKG FLYDQGLEPK  360
EGFPNMSDLH LGGGANNHNG VSASPPILDA PNVYGGGGSG GGFFG
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influence vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Modulates root growth. {ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:18835563}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp6g31310
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expression repressed by LDL1 via histone H3 and H4 deacetylation. {ECO:0000269|PubMed:18835563}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2052660.0GU205266.1 Brassica rapa subsp. pekinensis lateral root primordium 1 (LRP1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001190295.10.0Lateral root primordium (LRP) protein-like protein
RefseqXP_013727118.10.0protein LATERAL ROOT PRIMORDIUM 1-like
SwissprotQ94CK91e-163LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA0A397XVM50.0A0A397XVM5_BRACM; Uncharacterized protein
STRINGAT5G12330.40.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58832646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.41e-166Lateral root primordium (LRP) protein-related
Publications ? help Back to Top
  1. Estornell LH,Landberg K,Cierlik I,Sundberg E
    SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis.
    Front Plant Sci, 2018. 9: p. 150
    [PMID:29491878]