PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp6g22010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 274aa    MW: 31490.7 Da    PI: 8.8514
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp6g22010genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF73.12.3e-231662349
               --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
     SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                en+sn qvtfskRr g++KKA+EL++LCdae+a+i+fs+  k++ +
  Tp6g22010 16 MENESNLQVTFSKRRSGLFKKASELCTLCDAEIAIIMFSPGKKVFSF 62
               69**************************************9999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.4E-33665IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.558666IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.94E-27781IPR002100Transcription factor, MADS-box
CDDcd002652.99E-33779No hitNo description
PRINTSPR004042.6E-19828IPR002100Transcription factor, MADS-box
PfamPF003197.0E-251562IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-192843IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-194364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009960Biological Processendosperm development
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MVKKSKGRQK MKMVKMENES NLQVTFSKRR SGLFKKASEL CTLCDAEIAI IMFSPGKKVF  60
SFGHPNVDIV INRFLNINHP PPNQDINIQR RNSVIQDLNN HLTQVMDQLE LEKKKNEELQ  120
KVRENSKKPM NWWEEPIEGF DLAQAKEFKG NLENLKRLVT LEASKFFQAT VPCQNFYVGS  180
SSNAPFGGYG GHSINPNMDQ INQRSMMNMS AFYNQNMVFP NHPLPFGNNN HAEGFVPAYN  240
LNYGSEYYQN QNLSFKKENI SENENHHDGH PPSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-16786284MEF2C
5f28_B4e-16786284MEF2C
5f28_C4e-16786284MEF2C
5f28_D4e-16786284MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp6g22010
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002864686.11e-121agamous-like MADS-box protein AGL62
SwissprotQ9FKK21e-119AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLD7MTU51e-119D7MTU5_ARALL; MADS-box protein
STRINGfgenesh1_pg.C_scaffold_80020411e-120(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.11e-113AGAMOUS-like 62
Publications ? help Back to Top
  1. Xu W, et al.
    Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds.
    Plant Cell, 2016. 28(6): p. 1343-60
    [PMID:27233529]
  2. Figueiredo DD,Batista RA,Roszak PJ,Köhler C
    Auxin production couples endosperm development to fertilization.
    Nat Plants, 2015. 1: p. 15184
    [PMID:27251719]
  3. Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C
    Auxin production in the endosperm drives seed coat development in Arabidopsis.
    Elife, 2017.
    [PMID:27848912]
  4. Fiume E,Coen O,Xu W,Lepiniec L,Magnani E
    Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal.
    Plant Signal Behav, 2017. 12(8): p. e1339000
    [PMID:28613109]
  5. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]