PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp6g17600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 263aa    MW: 30122.9 Da    PI: 6.5035
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp6g17600genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.98.2e-16344243
               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
               ri n+  r +t+ kR++ + KKA+E S+LC+++ ++i+++++
  Tp6g17600  3 RITNEKTRITTYKKRKACLYKKANEFSTLCGVKTCLIVYGQS 44
               89*************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-6153IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.53E-16188IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.652144IPR002100Transcription factor, MADS-box
CDDcd002661.25E-21175No hitNo description
PfamPF003196.7E-16344IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MARITNEKTR ITTYKKRKAC LYKKANEFST LCGVKTCLIV YGQSRAGDER INDPELWPRD  60
ESKVREIISK YRDTASSSCT KTYSVQECLE KSKTKVEKMK YCPWDERLDK CSLNELYAAF  120
VVVGNKIQEA ANRNQHFPDA SWSNDQLSLF GYNQQCLEQH QLFPLSTMEQ NGFTFLPFPN  180
QMTSNTAEVA SFSNVTEPEI AQAMFYGSCS DDQYASVVQR TAYMETMQWG LGNSVFNNVK  240
TFADYPMRFG QVNDFENSAT TSM
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction. {ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp6g17600
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009132360.11e-159PREDICTED: agamous-like MADS-box protein AGL82
SwissprotQ9FIM04e-47AGL82_ARATH; Agamous-like MADS-box protein AGL82
TrEMBLA0A397ZU831e-158A0A397ZU83_BRACM; Uncharacterized protein
TrEMBLM4EJJ91e-158M4EJJ9_BRARP; Uncharacterized protein
STRINGBra028965.1-P1e-159(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59481947
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-148M-type_MADS family protein
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]