PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp6g13570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 234aa    MW: 27617.4 Da    PI: 7.4553
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp6g13570genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF30.16.4e-101553240
               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
               +ie++  r+ tf kR   +lKK +EL  LC+++ ++i+f
  Tp6g13570 15 FIEDDKARKSTFKKRTSPVLKKCNELMKLCNVKSCMIVF 53
               8************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.442653IPR002100Transcription factor, MADS-box
SMARTSM004326.6E-7667IPR002100Transcription factor, MADS-box
CDDcd002664.85E-15782No hitNo description
SuperFamilySSF554552.88E-12883IPR002100Transcription factor, MADS-box
PfamPF003199.9E-121554IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MTMRIKMKKK VKLAFIEDDK ARKSTFKKRT SPVLKKCNEL MKLCNVKSCM IVFPKPPNEG  60
VQELSSKFKE VSLGNQKKKM VNQSIITKPD EQDEQDGVCE ETLREKGESS LSVPPRPDVT  120
PSWYDNHMKQ SQNLYEYHAQ IPQKLHEFNM MQSSNQNQKQ KEPFQFNCQT LYDFYDGIPQ  180
QLEAFNKKYN LRPYEYFESI DPNWKMDPSL NENQDFMDTP KEHMDTPKEH IDDA
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp6g13570
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB2BFH92e-21B2BFH9_ARATH; Pheres1 (Fragment)
TrEMBLB2BFI02e-21B2BFI0_ARATH; Pheres1 (Fragment)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65330.14e-30M-type_MADS family protein