PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp6g13190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 171aa    MW: 19702.3 Da    PI: 6.309
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp6g13190genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF49.17.3e-161255649
               HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
     SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
               +++++ tfs+Rr g++KKA+EL + C+a+v ++ifs+++k y +
  Tp6g13190 12 QTRKHATFSRRRSGVFKKASELATKCNAKVGIVIFSPEDKPYSF 55
               799***********************************998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.969159IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-9121IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-19158IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-19571IPR002100Transcription factor, MADS-box
PfamPF003194.7E-181355IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-92136IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-93657IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MDERKIKMEK VQTRKHATFS RRRSGVFKKA SELATKCNAK VGIVIFSPED KPYSFGTPSL  60
DVVLERFKNE DEESDNIDEG SINELEKLQK HLNSINEKVD AEEKRGKEYQ KRLESAGERF  120
EKNLEELTLE KLNENKDMLE KMHGMIQSNI DRMQASTALM LLSKDKGYGG E
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp6g13190
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006407920.16e-54agamous-like MADS-box protein AGL29
SwissprotO647033e-52AGL29_ARATH; Agamous-like MADS-box protein AGL29
TrEMBLV4MA981e-52V4MA98_EUTSA; Uncharacterized protein
STRINGXP_006407920.12e-53(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.12e-46AGAMOUS-like 29
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]