PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp6g07320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 287aa    MW: 32046.7 Da    PI: 4.0542
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp6g07320genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF252.4e-081653239
               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEE CS
     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevavii 39
               +i nk    + f+kRrng+  K + L+ L da++av+ 
  Tp6g07320 16 KIANKEFLATAFTKRRNGLYSKVSQLCLLSDAKIAVLA 53
               688999999***************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006612.937752IPR002100Transcription factor, MADS-box
SMARTSM004323.0E-9766IPR002100Transcription factor, MADS-box
CDDcd002662.40E-19885No hitNo description
SuperFamilySSF554551.44E-12980IPR002100Transcription factor, MADS-box
PfamPF003192.7E-81654IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MVKRSGGTKR KITIEKIANK EFLATAFTKR RNGLYSKVSQ LCLLSDAKIA VLATPASSHS  60
NVSFNSFGHS SVDAIVTAYL TGQRPLSSVR EEMREDVGIC LARKDIGLGL WWEDELLVRS  120
ENPDELTKAI NSMSTLLQKL KEFRSGEAEK SESDETLNPP VCCIPDDDLP ADLNNNNALT  180
GSLDQEMDID QLIDFNTFEI SDFDDLFFES NHNDKTESDQ TPNFPIRCCL PDDEIVDDLP  240
SKFNDITEEQ SQILATCEAV DDLPVNVDEI TEEEQSQLLA LCESLWV
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp6g07320
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006396884.15e-76agamous-like MADS-box protein AGL97
SwissprotQ9C6336e-43AGL97_ARATH; Agamous-like MADS-box protein AGL97
TrEMBLV4L7L91e-74V4L7L9_EUTSA; Uncharacterized protein
STRINGXP_006396884.12e-75(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45417145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49420.11e-68M-type_MADS family protein
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]