PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp5g34480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family G2-like
Protein Properties Length: 355aa    MW: 39285.2 Da    PI: 8.962
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp5g34480genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1071e-333488155
    G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
               kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Tp5g34480 34 KPRLRWTVELHERFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 88
               79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8013191IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-323189IPR009057Homeodomain-like
SuperFamilySSF466891.76E-163389IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-233489IPR006447Myb domain, plants
PfamPF002492.6E-83686IPR001005SANT/Myb domain
PfamPF143791.9E-21129169IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MFHAKKPSSM NGSYENRAMC VQGDSGLVLT TDPKPRLRWT VELHERFVDA VAQLGGPDKA  60
TPKTIMRVMG VKGLTLYHLK SHLQKFRLGK QPHKEYGDHS TKEGSRASAM DIQRNVASSS  120
GMMSRNMNEM QMEVQRRLHE QLEVQRHLQL RIEAQGKYMQ SILERACQTL AGENMAAATA  180
AAAGGGYKGN LGSSSLSAAV GPHALSFPPF QDLNIYGNTT DQVLEHHNFH HQNIENHYTA  240
NNAADTNIYL GKKRPNPSFG NDVRKGLLMW SDQDHDLAGN QPIDDEHRIQ IQMATHVSTD  300
LDSLSEIYER KSGLSGDEGN NGGKLLERPS PRRSPLSPMM NPNGGLIQGR NPPFG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3167190.0AK316719.1 Arabidopsis thaliana AT1G79430 mRNA, complete cds, clone: RAFL09-57-C07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302459.10.0hypothetical protein CARUB_v10020551mg
SwissprotQ9SAK50.0APL_ARATH; Myb family transcription factor APL
TrEMBLR0GHL10.0R0GHL1_9BRAS; Uncharacterized protein
STRINGAT1G79430.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50442750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.20.0G2-like family protein