PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp5g31480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family Nin-like
Protein Properties Length: 824aa    MW: 92005.5 Da    PI: 6.5306
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp5g31480genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.71.3e-29556607152
     RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Tp5g31480 556 AEKNITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 607
                589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.166546627IPR003035RWP-RK domain
PfamPF020421.3E-25559607IPR003035RWP-RK domain
SuperFamilySSF542772.7E-21716812No hitNo description
SMARTSM006663.4E-24726809IPR000270PB1 domain
PROSITE profilePS5174527.147726809IPR000270PB1 domain
PfamPF005648.7E-18727808IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.9E-19727806No hitNo description
CDDcd064071.22E-38727808No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 824 aa     Download sequence    Send to blast
MENNSLPMDP AMDSALMDGL LLEGCWLETP DASDFLNFSP STSIAPFDPS HFMWSPTTQD  60
TAICSSSLSQ MYGQDCAERS SLEDHHHHQG KDLSSLNRRW WIGPSGHGSS IMDRLVQAVK  120
HIKDFTSERG GSLIQLWVPV ERGGKRVLTT KEQPFSHDPM CQRLAHYREI SVNYQFSAEQ  180
EDSNSNSDSS SKDLVGLPGR VFLGQVPEWT PDVRFFKNEE YPRVQHAQDC DVRGTLAIPV  240
FEQGSKICLG VIEVVMTTQM VKLSPELESI CRALQAVDLR STEVPISPPL KGPDVPYQAA  300
LPEIRNLLRC ACETHKLPLA QTWVSCLKQS KTGCRHNNEN YIHCVSTIDD ACYVGDPTVR  360
EFHEACSEHH LLKGQGVVGE AFLTNGPCFS SDVSSYKKSD YPLSHHATMF GLHGTVAIRL  420
RCIHTGSADF VLEFFLPKNC RDIEEQRKML NALSTIMAHV PRSLRTVTEK ELEDEGDSMA  480
SEVVERGKTL PKIENTSELH QGNHNPQNVG LVIDGGTSEM GELGFDNAKV LSVNENRTFS  540
SAGGFSRMTE KKRTKAEKNI TLDVLRQYFA GSLKDAAKSI GVCPTTLKRI CRQHGIQRWP  600
SRKIKKVGHS LQKIQRVIDS VQGVSGHHLP IGSFYANFPN LASSQEASSL QQQSKKTTFL  660
SSSHSHPAKS PASSCSHSSS CSSETQVNKE DPTNKTGEDT VTLSRSFKET PATQLSPSTS  720
SQDDDFLRIK VSYEEEKIRF KMRNSRRLND LLWEIAKRFS IEDVSRYDLK YLDEDSEWVL  780
LRCDDDVEEC VDVCRSFPGQ TIKLLLQPST QHIQERSSVS GCLS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp5g31480
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935370.0AB493537.1 Arabidopsis thaliana At1g76350 mRNA for hypothetical protein, partial cds, clone: RAAt1g76350.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390206.10.0protein NLP5
RefseqXP_024008182.10.0protein NLP5
SwissprotQ9SFW80.0NLP5_ARATH; Protein NLP5
TrEMBLV4KCL80.0V4KCL8_EUTSA; Uncharacterized protein
STRINGXP_006390206.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein