PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp5g29630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 291aa    MW: 33437.9 Da    PI: 7.1865
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp5g29630genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.43.4e-22953145
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
               kr e+ snr+vt++kRr gilKKA+ELS+LCd+++ +++fs+tg+
  Tp5g29630  9 KRLESISNRKVTYTKRRSGILKKAKELSILCDIDIVLLMFSPTGR 53
               688999*************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-28160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.025161IPR002100Transcription factor, MADS-box
CDDcd001202.48E-22257No hitNo description
SuperFamilySSF554551.16E-24294IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-17323IPR002100Transcription factor, MADS-box
PfamPF003194.6E-191255IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGRVKLMIKR LESISNRKVT YTKRRSGILK KAKELSILCD IDIVLLMFSP TGRPTIFHGD  60
HRCIGDVIAK FAQLTPQERT KRKLESLEAL KKTFMKLDHD VNIHEFLGAR NQTIEGLTNQ  120
VAFFQAQVLE CHRRLSCWAN IGRIENMEHL ANLEESLRKS IDRIQVHKIS SPLSIKDIQE  180
NHSLSWLPCN NNQQMIIPGD SSFIPHRDMA DRAAASLSVY SSFFESGNQE DQICNLEQQF  240
DHLRQEGNVF EPGLQEEKEF GPDHHHQTWI SDSSCCSNSA YRHSDNNQQP D
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp5g29630
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010428431.11e-132PREDICTED: agamous-like MADS-box protein AGL65 isoform X2
SwissprotQ7X9I01e-124AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLD7KH661e-124D7KH66_ARALL; AGL102
STRINGXP_010428430.11e-129(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59332543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.11e-126AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]