PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp5g27440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 224aa    MW: 25407.9 Da    PI: 8.6195
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp5g27440genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.51.5e-225098149
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
               k i+++ +rqvtfskRrng++KKA ELSvLC+a++ +i fs   ++y +
  Tp5g27440 50 KEIKEENRRQVTFSKRRNGLFKKAAELSVLCGAQIGIITFSRCERIYAF 98
               6799**************************************9999988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.9E-2742101IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-2342112IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.45542102IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-204464IPR002100Transcription factor, MADS-box
PfamPF003194.0E-225298IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-206479IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-2079100IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MEDGEASSTT CFPFTGQKPL KTPNFQVKQQ KETKLQKPKT TKGRQKIEIK EIKEENRRQV  60
TFSKRRNGLF KKAAELSVLC GAQIGIITFS RCERIYAFGN VDTLIEKYLR KTPVMLRSQL  120
GGDVAAGGAD EDGRMWWERA VESVPEEEMD EYMKGLSGLR ENLWTRICEM GGDPTVQMNA  180
QAFPNPMAPV DWKMTDVRNE QGQAGNDGFL DFASVPFLSQ NRRQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp5g27440
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895751e-176AC189575.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH011C10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009104862.11e-119PREDICTED: agamous-like MADS-box protein AGL61
RefseqXP_013651170.11e-119agamous-like MADS-box protein AGL61
TrEMBLA0A397YVN81e-118A0A397YVN8_BRACM; Uncharacterized protein
STRINGBra003884.1-P1e-118(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46972052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72350.11e-81M-type_MADS family protein