PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp5g22450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 432aa    MW: 48368.9 Da    PI: 4.4336
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp5g22450genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF27.15.4e-091351240
               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
               +ie k  ++vtfskRr+g+  K + L+ L + ++a+++ 
  Tp5g22450 13 KIEKKGSKSVTFSKRRKGLYSKTSQLCLLSGGQAAILVT 51
               699999*****************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.9E-7163IPR002100Transcription factor, MADS-box
PROSITE profilePS5006611.956458IPR002100Transcription factor, MADS-box
CDDcd002661.28E-20583No hitNo description
SuperFamilySSF554551.7E-111080IPR002100Transcription factor, MADS-box
PfamPF003193.0E-101357IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MGGLKRKIST DQKIEKKGSK SVTFSKRRKG LYSKTSQLCL LSGGQAAILV TPPCSKSHVS  60
FYSFGHSSVD TVVSSFLANQ QPPREDLGSE FRWWEDDESL AKSEDSEELS EAVDSISRML  120
QNLKGLRSAA MENREDMKKK KTKKKKELVL HGTHDKNQTL NLQPTCASIC CVQDEEDPLE  180
TFQGIVKNIE EEDQIVASSD SNNNNVVIHE THHRNQTLDL PSTSSASLCV QDVSSENFEW  240
FFKNVEQKED QMVAISNSNN NNNSGLPGNF NGFNQKFDLD QFVDVETNSE SLISTNLEVN  300
DVSANRFSYS GSEGGEDGAM VVQSYSNKDN LHHVSELNED KIEAISDNNN NNDLPGDLYR  360
CSHQEVDTDQ IYDSVKNSET TDVSMMMNTK QNRCSNSEEA VEDGAVVFHR DLDQDNLQFS  420
DFFNELLSMG EL
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp5g22450
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022548769.11e-110agamous-like MADS-box protein AGL97
TrEMBLA0A0D3EHV01e-104A0A0D3EHV0_BRAOL; Uncharacterized protein
TrEMBLA0A3P6EAE21e-104A0A3P6EAE2_BRAOL; Uncharacterized protein
STRINGBo9g178940.11e-105(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45417145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04640.13e-52AGAMOUS-like 99