PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp5g15040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family G2-like
Protein Properties Length: 339aa    MW: 35945.5 Da    PI: 5.6746
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp5g15040genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.15.4e-30158211155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Tp5g15040 158 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 211
                59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.252153214IPR017930Myb domain
SuperFamilySSF466891.77E-19155215IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-30157216IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-23159211IPR006447Myb domain, plants
PfamPF002496.1E-8161210IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGEEVRMNDY DVSGDGDRVL EWEMGLPSDE DLAALSYSLI PSNLAMAFSI APEKSRTIQD  60
VNRASETTLS SLRSGSSGPN TSSSNNNSNS FKTGVAVEEE DRVGSSSPGS DSKKQKTSDD  120
AGDGGGGGGG DVDLSTVDAA AEEGDSGTED PTGKTLKRPR LVWTPQLHKR FVDVVAHLGI  180
KNAVPKTIMQ LMNVEGLTRE NVASHLQKYR LYLKRMQGLT TEGPSSSDKL FSSTPVPPQS  240
FQDIGGGSGQ GNGSAGHVGM PIPVPYGAPP MMQMPVYAHH MGMQGYHHQN HGHDPYHQNH  300
HHGTGGPGAF EANPYMMQQN KFGSMASYPS VGGGSANEN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-20157216463ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006418876.10.0hypothetical protein EUTSA_v10002605mg
SwissprotQ9SNB40.0PCL1_ARATH; Transcription factor LUX
TrEMBLV4L4U30.0V4L4U3_EUTSA; Uncharacterized protein
STRINGBra018204.1-P1e-175(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40552758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.21e-168G2-like family protein