PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp5g14060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family LBD
Protein Properties Length: 328aa    MW: 37447.8 Da    PI: 5.6783
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp5g14060genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601223.2e-38381371100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                aCaaCk++rr+Ca+dC+lapyfpaeqpk f+nvh+lFG++ ++k+l++l+e+++++am+s+++++ +r r+Pv+G++g+ ++lq  +  +++el++++++
  Tp5g14060  38 ACAACKYQRRRCAADCPLAPYFPAEQPKLFQNVHRLFGVRSIVKILENLDESQKPEAMKSIIFQSYVRDRNPVHGCLGITQHLQYMIFLAQEELKSVNSQ 137
                7**********************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.06837138IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-3538135IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MRPIKIIHHL TGLLERFLDR ILIVFILYMT LKGGSSGACA ACKYQRRRCA ADCPLAPYFP  60
AEQPKLFQNV HRLFGVRSIV KILENLDESQ KPEAMKSIIF QSYVRDRNPV HGCLGITQHL  120
QYMIFLAQEE LKSVNSQLQL YRNQQNNVQN HHNTHNQMIH EIGEKQEDVT SQLDLGMGLT  180
VNNNQNNLTS FFNPLSVSET QQQPQMSYTY SCSEVNNNGY SPPAYTDSCK EILANNNDNN  240
ASLAWGPNGF PYHHHNNGLS NQNEQCNEMK NSNGVMAIQS QLVNLQMVSN QQEEEEEDAH  300
EYDEIHQFLE IIDEKQSFAD TKEPNASS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-24341417114LOB family transfactor Ramosa2.1
5ly0_B2e-24341417114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp5g14060
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013591362.11e-172PREDICTED: LOB domain-containing protein 27-like isoform X1
RefseqXP_013591366.11e-172PREDICTED: LOB domain-containing protein 27-like isoform X2
SwissprotQ9STS61e-139LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A078J5G01e-170A0A078J5G0_BRANA; BnaC01g42830D protein
STRINGBo1g072490.11e-167(Brassica oleracea)
STRINGXP_006292170.11e-167(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-128LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]