PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp5g11150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family SRS
Protein Properties Length: 371aa    MW: 38762.5 Da    PI: 7.063
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp5g11150genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702231.51.5e-711362864153
     DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.aeaaskrkrelkskkqsalsstklssaeskkelet 102
                +++sCqdCGnqakkdCah RCRtCCksrgf+C thv+stWvpaakrrerqqql++ + ++++++ ++  +kr+re+  +++s+l +t+++++++ + le+
  Tp5g11150 136 NGVSCQDCGNQAKKDCAHIRCRTCCKSRGFECPTHVRSTWVPAAKRRERQQQLTTVQPQTQQRRgDSGVPKRQRENLPATSSSLVCTRIPTHHNASALEI 235
                4679*************************************************99988777766578899****************************** PP

     DUF702 103 sslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                 ++P evss+avfrcvrvssv+dgeee+aYqtavsigGh+fkGiLyd+G+ 
  Tp5g11150 236 GDFPGEVSSPAVFRCVRVSSVEDGEEEFAYQTAVSIGGHIFKGILYDHGPG 286
                *************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.4E-65137285IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.1E-26139181IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.8E-27238285IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MAGFFSLDGG GGGGGGGNSQ EEHRTNTNPP PPVSEAWLWY RNPNVNANTN TNAPSSSNAA  60
LGTLELWQNH NQQDIMFQHQ QHQQRLDLYS SAAGLGVGPS NHSQFDISGE TSNAGAGREA  120
ALMMMRSGGS GGGGGNGVSC QDCGNQAKKD CAHIRCRTCC KSRGFECPTH VRSTWVPAAK  180
RRERQQQLTT VQPQTQQRRG DSGVPKRQRE NLPATSSSLV CTRIPTHHNA SALEIGDFPG  240
EVSSPAVFRC VRVSSVEDGE EEFAYQTAVS IGGHIFKGIL YDHGPGSSEG GGGYNVITAG  300
ESSSGGGGAQ QLNLITAGSV TVATASSSTP NAGGICSSSA AAAVYIDPTS LYPTPINTFM  360
AGTQFFPNPR S
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:12361963, ECO:0000269|PubMed:16740145, ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:18811619, ECO:0000269|PubMed:20154152, ECO:0000269|PubMed:22318676}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBMTransfer from AT3G51060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp5g11150
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by ESR1 and ESR2. {ECO:0000269|PubMed:21976484}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2052620.0GU205262.1 Brassica rapa subsp. pekinensis stylish (STY1-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013744650.10.0protein SHI RELATED SEQUENCE 1-like
SwissprotQ9SD400.0SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLV4NGU30.0V4NGU3_EUTSA; Uncharacterized protein
STRINGXP_006403958.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34192864
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.11e-143Lateral root primordium (LRP) protein-related
Publications ? help Back to Top
  1. Estornell LH,Landberg K,Cierlik I,Sundberg E
    SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis.
    Front Plant Sci, 2018. 9: p. 150
    [PMID:29491878]