PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp5g01050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WRKY
Protein Properties Length: 297aa    MW: 33757.6 Da    PI: 7.3535
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp5g01050genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.31.5e-33129187159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK+v++s+fprsYYrCt+++C+vkk+vers +dp+ v++tYeg+H+h+
  Tp5g01050 129 LDDGYKWRKYGQKPVRNSPFPRSYYRCTTSSCNVKKRVERSFTDPSSVITTYEGQHTHP 187
                59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-33116189IPR003657WRKY domain
SuperFamilySSF1182901.14E-28122189IPR003657WRKY domain
PROSITE profilePS5081131.387124189IPR003657WRKY domain
SMARTSM007743.1E-38129188IPR003657WRKY domain
PfamPF031065.3E-26130187IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MEKIGVGMAF SGLGQTRVYE SFSDTSAERY PVGLMDLLSV HHQDISRYAL IHMPLMQPPA  60
TPNSSSSISY ASCEAVTGEE NKRGYHEDED EEEHQHTRCK RLRSTKSSEH TKMRVPKVSF  120
VTKSQVNNLD DGYKWRKYGQ KPVRNSPFPR SYYRCTTSSC NVKKRVERSF TDPSSVITTY  180
EGQHTHPRPL IMSKKGSFGS NGSAYGAHFD LMVPTLPPRL HLLFDYNNHH HQPQQDLSFF  240
GTEYLNTQVK GFDHGHEDDD HVTKTSRTQD LLDGAGLVKD HGLLQDVVPA HIIKEEY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-261221891077Probable WRKY transcription factor 4
1wj2_A2e-261221891077Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013658824.11e-156PREDICTED: probable WRKY transcription factor 68
SwissprotQ93WV61e-107WRK68_ARATH; Probable WRKY transcription factor 68
TrEMBLA0A078FDM01e-156A0A078FDM0_BRANA; BnaA09g39820D protein
STRINGBra007674.1-P1e-155(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM150681619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62340.11e-105WRKY family protein