PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp4g22950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family bZIP
Protein Properties Length: 371aa    MW: 41000.2 Da    PI: 6.6809
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp4g22950genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.91.4e-10149206562
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l+  +     l se
  Tp4g22950 149 KRAKRIIANRQSAARSKERKARYILELERKVQTLQTEATTLSAQLSLFQRDTTGLSSE 206
                9*****************************************9999887776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-16145209IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.53147210IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.97E-10149200No hitNo description
PfamPF001701.8E-9149207IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.7E-10149204No hitNo description
CDDcd147036.83E-22150199No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MEDHSNMKSN QCPPLANPAP APAPFRGPYH RRAHSEVQFR LPEDLDLSEP FGGFDELGSE  60
DDLFCSYMDI EKLGTGSGSA SDSAGPSAPR SDNPFSAENG GGGRDEAGNS RPRHRHSLSV  120
DGSSTLESIE AKKAMAPDKL AELWVVDPKR AKRIIANRQS AARSKERKAR YILELERKVQ  180
TLQTEATTLS AQLSLFQRDT TGLSSENTDL KLRLQVMEQQ AKLRDALNDQ LKKEVERLKF  240
ATGEVSPADA YNLGMAHMQY SQQQPKQSFF QHHQQQTDAQ NLQQMTHQFH LFQPNNNQNP  300
NMTSSASRQN PPTAHQLMHH ATSNASGQSH SFSEAMHEDP LGRLQGLDIS SCGRGSNFGR  360
SDTVSESSST M
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp4g22950
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0742690.0AY074269.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankAY0967460.0AY096746.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankZ860930.0Z86093.1 A.thaliana mRNA for b-Zip DNA binding protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411330.10.0bZIP transcription factor 18
SwissprotO228730.0BZP18_ARATH; bZIP transcription factor 18
TrEMBLV4MJI30.0V4MJI3_EUTSA; Uncharacterized protein
STRINGXP_006411330.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.10.0bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]