PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp4g16710
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 179aa    MW: 20366.2 Da    PI: 8.8355
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp4g16710genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF60.61.9e-191257449
               -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
     SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
               ++   rqvtfskRr+g++KKA+EL +LC+ae  +++fs+ gk + y
  Tp4g16710 12 QDMNTRQVTFSKRRTGLFKKASELATLCNAELGIVVFSPGGKPFSY 57
               56778**********************************9996665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.02161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.11E-26171IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-32160IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-19323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-231257IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MGRRKIKMEM VQDMNTRQVT FSKRRTGLFK KASELATLCN AELGIVVFSP GGKPFSYGKP  60
NLDAVTERFM RECDDSDSGG EEGRCNKNIP KLKKMNERLD FLNQEIEAEK KRGEKAQENF  120
ESAGDERFKK PIEKLTIDEL KEYNDKLQTV HDRIQGQISQ MQASSSLMLL LGNNKAPAE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A1e-15189184MEF2 CHIMERA
6byy_B1e-15189184MEF2 CHIMERA
6byy_C1e-15189184MEF2 CHIMERA
6byy_D1e-15189184MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp4g16710
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0040771e-153AC004077.3 Arabidopsis thaliana chromosome 2 clone T31E10 map ve016, complete sequence.
GenBankAC0044811e-153AC004481.3 Arabidopsis thaliana chromosome 2 clone F13P17 map ve016, complete sequence.
GenBankCP0026851e-153CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBankDQ4465981e-153DQ446598.1 Arabidopsis thaliana clone pENTR221-At2g34440 MADS-box family protein (At2g34440) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006410589.11e-101agamous-like MADS-box protein AGL29
SwissprotO647031e-96AGL29_ARATH; Agamous-like MADS-box protein AGL29
TrEMBLV4MAC21e-100V4MAC2_EUTSA; Uncharacterized protein
STRINGXP_006410589.11e-101(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.11e-92AGAMOUS-like 29
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]