PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp4g16310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WOX
Protein Properties Length: 388aa    MW: 43078.4 Da    PI: 8.7784
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp4g16310genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.5e-1854114257
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                ++R+++++eq+++Le+ F++   +p +ee++++ ++l    ++ +++V++WFqNr+ + k+
  Tp4g16310  54 KPRWNPKPEQIRILEAIFNSgMVNPPREEIRRIRAQLqeygQVGDANVFYWFQNRKSRSKH 114
                89*****************99*************************************995 PP

2Wus_type_Homeobox112.32.5e-3653115264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P++eei+ri+a+L+eyG+++d+NVfyWFQNrk+R+++k
          Tp4g16310  53 PKPRWNPKPEQIRILEAIFNSGMVNPPREEIRRIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 115
                        689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.68950115IPR001356Homeobox domain
SuperFamilySSF466893.68E-1251118IPR009057Homeodomain-like
SMARTSM003891.2E-852119IPR001356Homeobox domain
CDDcd000861.33E-853115No hitNo description
Gene3DG3DSA:1.10.10.601.1E-654113IPR009057Homeodomain-like
PfamPF000469.0E-1654114IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPHHHQ WQHDINSPLL PSSASHRSSP FSSGCEVERS PEPKPRWNPK  60
PEQIRILEAI FNSGMVNPPR EEIRRIRAQL QEYGQVGDAN VFYWFQNRKS RSKHKLRLLH  120
NHSKHSLPQQ QPQPQPQPLS SSNSASSSSS SSSSSSKSTK PRKNKNKNNN TNLSLGGSQM  180
MGMFPSEAAF LFPVSTVGGF EGTPVSSQLG FLSGDMIEQQ KPAPQTVGPC TGLLLSEIMN  240
GSVSYGTHHQ QDLSVKEDEE MRMKMMQQPQ PQICYATTSH QMSSYNNNIM LHVPPTTSTT  300
TTITTSDSLA IVQSTSDQLQ VQSGARIRVF INEMELEVSP GPFNVRDAFG EEVVLINSAG  360
QPIVTDEYGV AIHPLQHGAS YYLVLFPL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2514010.0AY251401.1 Arabidopsis thaliana WOX9 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006410541.10.0hypothetical protein EUTSA_v10016784mg
SwissprotQ6X7J40.0WOX9_ARATH; WUSCHEL-related homeobox 9
TrEMBLV4M6W20.0V4M6W2_EUTSA; Uncharacterized protein
STRINGAl_scaffold_0004_18720.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72062640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.11e-173homeobox-3