PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp4g11440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WOX
Protein Properties Length: 150aa    MW: 16723.3 Da    PI: 8.3052
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp4g11440genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.75.2e-10647238
               T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....T CS
   Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....g 38
               ++R+++t+eql +Lee++++  r+p+a ++++++++l    +
  Tp4g11440  6 STRWCPTPEQLMILEEMYRSgIRTPNAVQIQQITAHLafygR 47
               58*****************99**************9955553 PP

2Wus_type_Homeobox74.81.3e-24552249
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkN 49
                       a+tRW+PtpeQ++iLee+y+sG+rtPn+ +iq+ita+L+ yG+ie+kN
          Tp4g11440  5 ASTRWCPTPEQLMILEEMYRSGIRTPNAVQIQQITAHLAFYGRIEGKN 52
                       589********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF000461.1E-7747IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MSPVASTRWC PTPEQLMILE EMYRSGIRTP NAVQIQQITA HLAFYGRIEG KNGIGVEAQS  60
KVVNEYYCNK SGPEEMLMQK PITGQNSSSY GRDWMMMMDM GPRPSYPSSS SSSSPVPCCN  120
MMMNSPKIPL KTLELFPISS INSKQDSTKL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894322e-91AC189432.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB068E07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009133866.13e-50PREDICTED: WUSCHEL-related homeobox 3-like
RefseqXP_013740679.13e-50PREDICTED: WUSCHEL-related homeobox 3-like
SwissprotQ9SIB44e-38WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBLA0A078D4Q83e-50A0A078D4Q8_BRANA; BnaA03g22070D protein
TrEMBLM4C8F63e-50M4C8F6_BRARP; Uncharacterized protein
STRINGBra000484.1-P9e-50(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74802642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.13e-39WOX family protein