PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp4g06780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 176aa    MW: 20957.3 Da    PI: 9.9521
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp4g06780genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF51.41.4e-16953145
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
               krie    r+  +s+R++g+ KKAeE+SvLC+++v +++fs+t k
  Tp4g06780  9 KRIECLKERSSKYSRRKKGLVKKAEEMSVLCGVDVVLLVFSPTSK 53
               68888999*********************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.1E-21160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.016161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-20282IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-12323IPR002100Transcription factor, MADS-box
CDDcd002662.42E-18484No hitNo description
PfamPF003192.9E-161055IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-122338IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-123859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MGNRKTELKR IECLKERSSK YSRRKKGLVK KAEEMSVLCG VDVVLLVFSP TSKPTFFHSH  60
SRHLCKILEK LYIMSQEERE ERRAYTKQIL KKLLKKKNTE TPSENHYLLP ARYETPQEDG  120
KVIELRETRE SLYENISILR DWQNPNRIND LEQLKLMEDH LVSTLSQIRK LKIQED
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp4g06780
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022563677.11e-62agamous-like MADS-box protein AGL65
TrEMBLA0A0D3DVC82e-68A0A0D3DVC8_BRAOL; Uncharacterized protein
STRINGBo8g098790.13e-69(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73301838
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26320.11e-21AGAMOUS-like 33