PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp4g03860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 205aa    MW: 23665.4 Da    PI: 10.0895
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp4g03860genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.18.3e-221961345
               --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
     SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
               i+ +s rqvtfskRr+g++KKA+EL++LC+ae+ +i++s+  k
  Tp4g03860 19 IKKESHRQVTFSKRRAGLFKKASELCTLCGAEIGIIVYSPAKK 61
               8999***********************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.6E-30968IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.142969IPR002100Transcription factor, MADS-box
CDDcd002654.41E-331085No hitNo description
SuperFamilySSF554552.88E-281090IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-161131IPR002100Transcription factor, MADS-box
PfamPF003197.3E-251865IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-163146IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-164667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009559Biological Processembryo sac central cell differentiation
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MTLKKKESIG RQKIPMVKIK KESHRQVTFS KRRAGLFKKA SELCTLCGAE IGIIVYSPAK  60
KPFSFGHPSV ESVLDRYLSR NNMSLVQTQQ HHGNAASNSE LNMRWMQILS EVEEEKKKGQ  120
AMAEMRKVNA RRSMINWWER PVEEMSMVQL QEMKYGLEEL RKMVVSETNK ALFNEVKEDV  180
FGFLDNKEKV PSNVYDLGYG NGCRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A2e-15993195MEF2 CHIMERA
6byy_B2e-15993195MEF2 CHIMERA
6byy_C2e-15993195MEF2 CHIMERA
6byy_D2e-15993195MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp4g03860
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850058.11e-112AGAMOUS-like 61
RefseqXP_010417244.21e-112PREDICTED: agamous-like MADS-box protein AGL61
RefseqXP_010417245.21e-112PREDICTED: agamous-like MADS-box protein AGL61
SwissprotQ4PSU41e-113AGL61_ARATH; Agamous-like MADS-box protein AGL61
TrEMBLC0SV611e-112C0SV61_ARATH; Uncharacterized protein At2g24840 (Fragment)
STRINGAT2G24840.11e-111(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.11e-115AGAMOUS-like 61
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]