PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp4g00990
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WRKY
Protein Properties Length: 195aa    MW: 22541.2 Da    PI: 6.51
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp4g00990genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY86.72.1e-27105163159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYG+K+++g ++ r+Y++Ct++gC vkk +er++e+p++v +tY+g+Hnh+
  Tp4g00990 105 LDDGYKWRKYGKKSITGRPCLRHYHKCTHPGCIVKKLIERDTENPEYVLTTYRGRHNHP 163
                59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.6E-2599165IPR003657WRKY domain
PROSITE profilePS5081126.188100165IPR003657WRKY domain
SuperFamilySSF1182906.93E-24101165IPR003657WRKY domain
SMARTSM007744.6E-27105164IPR003657WRKY domain
PfamPF031063.1E-20106163IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MNYPSNPNPT FTDLAETFKF DDYDDDAFQM IMEEISLENL SPTLSWTSSE KLLTAEVTST  60
LQTSLSSSTM GLDIGDKDEI KKRKRDKNDP IIHVFKTKSI KEITLDDGYK WRKYGKKSIT  120
GRPCLRHYHK CTHPGCIVKK LIERDTENPE YVLTTYRGRH NHPSPSVVYY DSDDFDLTSL  180
NTWSFQTHTY SHSAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-201051661778Probable WRKY transcription factor 4
2lex_A3e-201051661778Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18087KKRKRDKN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00270DAPTransfer from AT2G21900Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006404643.11e-107hypothetical protein EUTSA_v10000331mg
SwissprotQ9SJ093e-80WRK59_ARATH; Probable WRKY transcription factor 59
TrEMBLV4NIM61e-107V4NIM6_EUTSA; Uncharacterized protein
STRINGBra030273.1-P1e-103(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM138351726
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21900.12e-61WRKY DNA-binding protein 59