PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp4g00580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family SRS
Protein Properties Length: 156aa    MW: 17685.2 Da    PI: 9.6282
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp4g00580genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70294.12.8e-29665564
     DUF702  5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaa 64
               + +C+dCGnqakk+C+++RCRtCCks++f+C+th+kstWvpa++r++++q +++ +  ++
  Tp4g00580  6 GRRCEDCGNQAKKECVYMRCRTCCKSKAFHCQTHIKSTWVPAYRRSHKHQSQTQHQPLST 65
               569*******************************************99776665544433 PP

2DUF70283.74.6e-266512396154
     DUF702  96 skkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                +++   ++++P+e+ss a frcv+vss+ddg+e++aYqt+v+igGhvf+GiL+dqGl++
  Tp4g00580  65 TTNAKRVRHFPAELSSLADFRCVKVSSLDDGKEQYAYQTTVNIGGHVFRGILHDQGLDK 123
                334456778***********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.2E-25663IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.5E-28950IPR006510Zinc finger, lateral root primordium type 1
PfamPF051429.1E-2366122IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016242.0E-2973121IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MMMIMGRRCE DCGNQAKKEC VYMRCRTCCK SKAFHCQTHI KSTWVPAYRR SHKHQSQTQH  60
QPLSTTNAKR VRHFPAELSS LADFRCVKVS SLDDGKEQYA YQTTVNIGGH VFRGILHDQG  120
LDKLLHTSSS SCPLTIASSF TNFMSGTQFP SHQKAL
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:16740146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp4g00580
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0068416e-55AC006841.7 Arabidopsis thaliana chromosome 2 clone F3K23 map mi148, complete sequence.
GenBankCP0026856e-55CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018438354.18e-83PREDICTED: protein SHI RELATED SEQUENCE 3
SwissprotQ9SJT88e-83SRS3_ARATH; Protein SHI RELATED SEQUENCE 3
TrEMBLD7LBD11e-82D7LBD1_ARALL; Uncharacterized protein
STRINGBostr.5022s0092.1.p3e-85(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91882638
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21400.13e-85SHI-related sequence3