PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp3g31560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family SRS
Protein Properties Length: 223aa    MW: 25050.6 Da    PI: 6.4947
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp3g31560genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702199.31.2e-61622082154
     DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa..aeaaskrkrelkskkqsalsstklssaeskke 99 
                rs t+sCqdCGnqak++C+h+RCRtCCks+g+dC thv+stW+p+akrrerqq  ++++++++ +    e+ +kr +e   +  ++l+s+ l++      
  Tp3g31560  62 RSATISCQDCGNQAKRGCTHMRCRTCCKSQGLDCPTHVRSTWIPIAKRRERQQPIETPTANRNGHGggVENIPKRYKEF--DLPATLDSSGLEMD----- 154
                67899************************************************99999988887764455555655554..66666666665554..... PP

     DUF702 100 letsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                 et+ +Peevss+a+frcvr+s+ ddg+ ++aYqt+v i+GhvfkGiLy+qG+e+
  Tp3g31560 155 -ETTIFPEEVSSDALFRCVRMSGTDDGDSQYAYQTTVGIAGHVFKGILYNQGPES 208
                .4567************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.8E-5965207IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.7E-2667109IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016248.8E-29159206IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MAGIGSSRNN EEDTQQKTNW LWYQNISSSN TSHNNQQQIW QQQSPHLYPD QINVCDVTTS  60
SRSATISCQD CGNQAKRGCT HMRCRTCCKS QGLDCPTHVR STWIPIAKRR ERQQPIETPT  120
ANRNGHGGGV ENIPKRYKEF DLPATLDSSG LEMDETTIFP EEVSSDALFR CVRMSGTDDG  180
DSQYAYQTTV GIAGHVFKGI LYNQGPESMF MPGTQFYENP PRS
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:16740146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp3g31560
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009102280.11e-124PREDICTED: protein SHI RELATED SEQUENCE 4 isoform X2
RefseqXP_013651437.11e-124protein SHI RELATED SEQUENCE 4-like
RefseqXP_018508512.11e-124PREDICTED: protein SHI RELATED SEQUENCE 4 isoform X2
SwissprotQ9SI191e-114SRS4_ARATH; Protein SHI RELATED SEQUENCE 4
TrEMBLA0A397YHC11e-128A0A397YHC1_BRACM; Uncharacterized protein
STRINGBra039917.1-P1e-123(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM151171519
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18120.11e-108SHI-related sequence 4