PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp3g29670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family TALE
Protein Properties Length: 498aa    MW: 55328.9 Da    PI: 6.5951
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp3g29670genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.11.4e-083213581954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yp+ +++  LA+++gL+  qV++WF N R +
  Tp3g29670 321 FEHflHPYPKDSDKIMLARQTGLSRGQVSNWFINARVR 358
                554458******************************88 PP

2BELL127.93.6e-41183254172
       BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                erqel++k +kLls+l+eVd+rYkqy++q+q+v+ssF+++ag+g+akpYt+lAl++iSrhFrcL+dai++qi
  Tp3g29670 183 ERQELHSKLSKLLSILDEVDRRYKQYYHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAISGQI 254
                79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.1E-71123252IPR006563POX domain
PfamPF075263.8E-47129251IPR006563POX domain
PROSITE profilePS5007111.564299362IPR001356Homeobox domain
CDDcd000861.36E-11302363No hitNo description
SMARTSM003895.9E-9302366IPR001356Homeobox domain
SuperFamilySSF466895.56E-17303369IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.1E-27305368IPR009057Homeodomain-like
PfamPF059209.4E-18319358IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MATYYKSSGS SDIYSRPNVV EFVPGNAMIY MNPAVSSYSE TFPGEANNVS ASKEIQVLSN  60
FGGASQMLEI QDSGSWRDQE DSERNCFPVM IRPTTGQGLS LGLSSQIETS RGNNNEYATQ  120
VVSGFTRTIH NSKYLKAAQE LLDEAVNVKK ALKQFQPEGD KIDEEKENNL QESSTNPDIP  180
QSERQELHSK LSKLLSILDE VDRRYKQYYH QMQIVVSSFD VIAGCGAAKP YTALALQTIS  240
RHFRCLRDAI SGQILVIRKS LGGEHDGLDG KGVGISRLRN VDQQVRQQRA LQRLGVMQPH  300
TWRPQRGLPD SSVLVLRAWL FEHFLHPYPK DSDKIMLARQ TGLSRGQVSN WFINARVRLW  360
KPMVEEMYKE EFTDALGENG PNFSSENTPE MAESPEQQIE SSSNNGHVPG VSSNSMGQNT  420
VARGGDPFMM VTEMTRNGSG GMSLTLGIQK TDARGDVPMS GGIANYGNTI PGTEFQYFNS  480
GKRQHRLGPS QLLHDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A7e-15308366563Homeobox protein Meis2
3k2a_B7e-15308366563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0006090.0BT000609.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g16400/F16F14.10) mRNA, complete cds.
GenBankAY0567960.0AY056796.1 Arabidopsis thaliana At2g16400/F16F14.10 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006409439.10.0hypothetical protein EUTSA_v10022660mg
SwissprotQ9SIW10.0BLH7_ARATH; BEL1-like homeodomain protein 7
TrEMBLV4M7810.0V4M781_EUTSA; Uncharacterized protein
STRINGAT2G16400.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28692563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.10.0BEL1-like homeodomain 7