PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp3g24480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 357aa    MW: 41861.9 Da    PI: 6.547
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp3g24480genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.81.6e-141252343
               --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
     SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
               i n++ r  tf +R+ gi+KK +EL +LCd++++ +++s+ 
  Tp3g24480 12 IANETSRRATFRRRKRGIMKKLKELVTLCDVKACAVVYSPY 52
               89*************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.203250IPR002100Transcription factor, MADS-box
SMARTSM004323.0E-19261IPR002100Transcription factor, MADS-box
CDDcd002666.68E-22386No hitNo description
SuperFamilySSF554551.44E-23397IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-8424IPR002100Transcription factor, MADS-box
PfamPF003197.6E-151253IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-82439IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-83960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MKTRSKVNLS LIANETSRRA TFRRRKRGIM KKLKELVTLC DVKACAVVYS PYNLNPEAWP  60
SREGAKEVVS RFMEVPMLER TKKMVNQEAY MWERIKKEEE KLETMHNKNR ESELKELMFD  120
CVKGKMIGYH HYDSKDIQDL CYFVDSYLNQ LNSRMNILMK NNESSSFHPV HAAAVEDMTH  180
VVAENEAVAT APIGFYDHIQ YQNMNLNQHE QVQCEAAIKV NDHNQYQNVN QQPVHYQATI  240
DDHIQDKDMN QQDPVQFQAH AGFYDDNQDR IYDMHLNHIM NLYSNHNMSQ NSNQYTNQQQ  300
SFMDPLMTYT RQMGYVDELT NINSMEDNHH HHHKLPTTDY MSSITTAATA DLSAHQQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11732RRATFRRRKRGIMKKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp3g24480
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26650.12e-64AGAMOUS-like 36