PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp3g23480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WRKY
Protein Properties Length: 474aa    MW: 52297.4 Da    PI: 7.9591
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp3g23480genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.57.4e-30116174160
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                ++DgynWrKYGqK vkg+ef rsYYrCt+++C++kk++e+s   +++v+++Y geH+h+k
  Tp3g23480 116 MEDGYNWRKYGQKLVKGNEFVRSYYRCTHPNCKAKKQLEKSP-GGQIVDTVYFGEHDHPK 174
                58****************************************.***************85 PP

2WRKY105.72.4e-33288346159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ++Dgy+WrKYGqK+vkgs++prsYYrC+s+gCpvkk+vers++d+k++++tYeg+H+h+
  Tp3g23480 288 VNDGYRWRKYGQKSVKGSPYPRSYYRCSSSGCPVKKHVERSSHDTKLLITTYEGKHDHD 346
                58********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081121.873111175IPR003657WRKY domain
SuperFamilySSF1182903.14E-24112175IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.3E-26113175IPR003657WRKY domain
SMARTSM007748.5E-34116174IPR003657WRKY domain
PfamPF031062.9E-23117173IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.2E-34274348IPR003657WRKY domain
SuperFamilySSF1182901.31E-28282348IPR003657WRKY domain
PROSITE profilePS5081134.991283348IPR003657WRKY domain
SMARTSM007741.3E-38288347IPR003657WRKY domain
PfamPF031063.0E-26289345IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MAEVGKVLAT DMELANSSET KAVDVIPTDK MEATPVTTVT RTETVVEGCE TEKCSGEIPE  60
SADCKKLLQL VPCTTASLSE VEVASEKAPT IPESGTVLSL QSGSEGSSPF IREKVMEDGY  120
NWRKYGQKLV KGNEFVRSYY RCTHPNCKAK KQLEKSPGGQ IVDTVYFGEH DHPKPLGSAG  180
PINQDRRSDV LTVVSKEKAS GSCVQTHRQT EPPKIHGGLH LSVVPSANDV KTAISQPSTI  240
KSDGIYKDNS SPASKRRKKG GNIEHIPMER PTNESRNVVH TQTLFDIVND GYRWRKYGQK  300
SVKGSPYPRS YYRCSSSGCP VKKHVERSSH DTKLLITTYE GKHDHDMPPG RIVTHNNTLD  360
SEVDDKEVSA RDTEVNKTPQ SSALQTMTKD QHVEDHPKKK AKTNGFEKSL DQGPVLDAKP  420
KEQIKDGSDV TKDQAANHIK SETKSDDKTT VCHENTARTL ESQEQKPKAE SRQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A9e-48115350176WRKY transcription factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1396402PKKKAKT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00094SELEXTransfer from AT2G04880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3530570.0AK353057.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-10-D23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006418533.10.0hypothetical protein EUTSA_v10002517mg
RefseqXP_006418534.10.0hypothetical protein EUTSA_v10002517mg
SwissprotQ9SI370.0WRKY1_ARATH; WRKY transcription factor 1
TrEMBLE4MX100.0E4MX10_EUTHA; mRNA, clone: RTFL01-10-D23
TrEMBLV4L0100.0V4L010_EUTSA; Uncharacterized protein
STRINGAT2G04880.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79492639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.20.0zinc-dependent activator protein-1