PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp3g23070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family G2-like
Protein Properties Length: 289aa    MW: 32654.4 Da    PI: 6.0571
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp3g23070genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.73.5e-3090144155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                k+rlrW+++LH +Fv ave+LGG++kAtPk++ e+m+v+g++l+hvkSHLQk+Rl
  Tp3g23070  90 KARLRWSSDLHGCFVTAVEKLGGPDKATPKAVQEIMEVEGIALHHVKSHLQKFRL 144
                68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-2687144IPR009057Homeodomain-like
SuperFamilySSF466893.76E-1389144IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-2590145IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MSSQELKKKE KGKEIVTFED NPSTSLHHVD HFDEMEEVSM YFSEKGITAL LEANKEKQDK  60
KDNAEKVDVE EKKSPSSKIT PCIFYTSDDK ARLRWSSDLH GCFVTAVEKL GGPDKATPKA  120
VQEIMEVEGI ALHHVKSHLQ KFRLGKCNIR DESDPYNKRF INPYVSNEPQ SMPSSSTITK  180
LNDDRLNPAF LPTAVPPTVD SLHQGTLNST FPFSTTPQSV QTYVPRPTYT YPAYNTLEAV  240
KARLSELQNS STSQTRATTS HETNLPSSVP RDEEDPVDKF WSKSFTLEY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006418607.11e-136hypothetical protein EUTSA_v10002873mg
TrEMBLV4LBC51e-136V4LBC5_EUTSA; Uncharacterized protein
STRINGBra015134.1-P1e-120(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM134061520
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G06020.11e-110G2-like family protein