PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp3g20480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family CPP
Protein Properties Length: 613aa    MW: 67449 Da    PI: 7.6291
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp3g20480genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR48.32e-15317354239
        TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                ++k+CnCkkskClk+YCeCfaag++C e C+C  C+Nk
  Tp3g20480 317 SCKRCNCKKSKCLKLYCECFAAGVYCIEACSCVVCFNK 354
                689**********************************8 PP

2TCR52.78.4e-17402440139
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                ++k+gCnCkks+ClkkYCeCf+ g+ Cs +C+Ce+CkN 
  Tp3g20480 402 RHKRGCNCKKSNCLKKYCECFQGGVGCSINCRCEGCKNA 440
                589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.2E-16316357IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.747317442IPR005172CRC domain
PfamPF036382.1E-11319354IPR005172CRC domain
SMARTSM011142.1E-17402443IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.6E-12404440IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 613 aa     Download sequence    Send to blast
MDTPPKTVTE MGTPISKFKV ENSPVYNYIN SLSPIKPVES IPMSQTFGFF TSLPSVFNSS  60
HAASHKTSPF RTHSNSSDPS NVESSSIGEE MVKEALLETE PPQILKNDSP ATLTPRAINE  120
GSREDGKTDL QKMNDASVKP KSDTPDWSTL ISDSEILIYG SPPDPEAFTC FLQRPSDSKT  180
RLSGCSKPTL EPVPNSNELE SSDALSILHR GVRKRCLEFE MPGNNKQTTG ESSSRYVVPS  240
IGLHLNAIAM SSKDKSFSNE YSFSRNINVG LQRSTTPFFP SHETWEAAGQ DIVEGPKSLA  300
LVEMNQSKSE LVEGESSCKR CNCKKSKCLK LYCECFAAGV YCIEACSCVV CFNKPIYEDT  360
VLATRKQIES RNPLAFAPKV IRKADFITEA GDDASKTPAS ARHKRGCNCK KSNCLKKYCE  420
CFQGGVGCSI NCRCEGCKNA FGRKDAYVLA IMESKQEEDH ETYEKRTAQI QQNSDLSKEV  480
EQTPSSDQPS TPLPPYRHLV VHQPFLSKNR LPPTQFFLGA GSSSFRKPDG DLTQSTNEKK  540
RLETVTEDET EIMPEILSNS PITTIKAISP NSKRVSPPHL GSSESGSVLG KRSNGRKLIL  600
RSIPAFPSLN PNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1532143914120Protein lin-54 homolog
5fd3_B1e-1532143914120Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00370DAPTransfer from AT3G22780Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp3g20480
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024015205.10.0protein tesmin/TSO1-like CXC 3
SwissprotQ9LUI30.0TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLA0A3P6G5980.0A0A3P6G598_BRAOL; Uncharacterized protein
STRINGBostr.19424s0382.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  3. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]