PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp3g17710
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 280aa    MW: 32179.2 Da    PI: 8.1694
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp3g17710genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.71.1e-211762449
               -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
     SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
               +n+ n qvtfskRr g++KKA+EL++LC+ae+ vi+fs+  k++ +
  Tp3g17710 17 KNENNLQVTFSKRRSGLFKKASELCTLCGAEIVVIVFSPGRKVFSF 62
               8999***********************************9999877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.913666IPR002100Transcription factor, MADS-box
SMARTSM004325.4E-32665IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.01E-26787IPR002100Transcription factor, MADS-box
CDDcd002652.09E-33778No hitNo description
PRINTSPR004047.4E-18828IPR002100Transcription factor, MADS-box
PfamPF003191.4E-231662IPR002100Transcription factor, MADS-box
PRINTSPR004047.4E-182843IPR002100Transcription factor, MADS-box
PRINTSPR004047.4E-184364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MARKNKGRQK IEMVKMKNEN NLQVTFSKRR SGLFKKASEL CTLCGAEIVV IVFSPGRKVF  60
SFGHPDVNLV TDRFLNLNPP HPQQHNNMQL NEVRRNAVIR DLNNHLTLLT DQLEAEKKRN  120
EDLKQKRKES KMPESWWEEP IEEFNLCQLA EFKRGLENLK KTVTTEASKY LQATAPPHNF  180
YVGSSSNAAF GISNGDGNIN TDLDLFNHQR MVGMNTFACN HHNMIVPNQT TTPFENNGNN  240
NVTEGFVAPE NQNQYCFKQE RISECDHHPD HPLHFGHGYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6bz1_A4e-17795290MEF2 CHIMERA
6bz1_B4e-17795290MEF2 CHIMERA
6bz1_C4e-17795290MEF2 CHIMERA
6bz1_D4e-17795290MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp3g17710
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006406472.11e-156agamous-like MADS-box protein AGL62
SwissprotQ9FKK21e-106AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLV4LBV31e-154V4LBV3_EUTSA; Uncharacterized protein
STRINGXP_006406472.11e-155(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.13e-98AGAMOUS-like 62
Publications ? help Back to Top
  1. Xu W, et al.
    Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds.
    Plant Cell, 2016. 28(6): p. 1343-60
    [PMID:27233529]
  2. Figueiredo DD,Batista RA,Roszak PJ,Köhler C
    Auxin production couples endosperm development to fertilization.
    Nat Plants, 2015. 1: p. 15184
    [PMID:27251719]
  3. Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C
    Auxin production in the endosperm drives seed coat development in Arabidopsis.
    Elife, 2017.
    [PMID:27848912]
  4. Fiume E,Coen O,Xu W,Lepiniec L,Magnani E
    Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal.
    Plant Signal Behav, 2017. 12(8): p. e1339000
    [PMID:28613109]
  5. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]