PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp3g16720
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 375aa    MW: 42683 Da    PI: 9.9932
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp3g16720genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.53e-223175650
               HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
     SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
               +s + ++++kR+++++KKA+ELS+LC+++v+vi+++s+g+l +++
  Tp3g16720 31 SSLKAISLTKRQETVFKKAYELSTLCGIDVCVIYYGSDGELNTWP 75
               677899**************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.1E-51877IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.1E-1732107IPR002100Transcription factor, MADS-box
CDDcd002667.93E-2134101No hitNo description
PROSITE profilePS5006612.2363478IPR002100Transcription factor, MADS-box
PfamPF003192.9E-143574IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-54055IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-55576IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MASSSSSSFP SSTKKPTKVS QIRQTLFKKP SSLKAISLTK RQETVFKKAY ELSTLCGIDV  60
CVIYYGSDGE LNTWPEDREK VKEMARRYSE LSEKKRRKKR VGLDQFIEKI NKGDSKKNKK  120
KKVKLGSTYK YPDWDPRFDN CSVEQLTELI QSLERSQTIL QHRLRAVVES QRQRNMHYRN  180
MAGQEQMIAT TTATATARND LQQHSNQVSM NLFNPGNGAL SQIPVSASAF NQAQSLAPIP  240
DSLTIYQNPS MERYMRLLGE QETGINTNML PYNNSVNVFP RQFYQNCFKV DDHTGFPGRQ  300
ETGINNVNVG DYSGSLWAQG TGINGLQNMD MYSYNSNNNT SGFSNQLVQF PTQRAASVFQ  360
SMDRSTQNIR HLYEM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19397KKRRK
29398KKRRKK
39399KKRRKKR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction. {ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp3g16720
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009146116.11e-158PREDICTED: agamous-like MADS-box protein AGL103
SwissprotQ9LSB21e-111AG103_ARATH; Agamous-like MADS-box protein AGL103
TrEMBLM4E0P41e-157M4E0P4_BRARP; Uncharacterized protein
STRINGBra022341.1-P1e-158(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56620126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18650.14e-99AGAMOUS-like 103
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]