PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp3g12270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family NF-YA
Protein Properties Length: 320aa    MW: 35294.5 Da    PI: 10.4075
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp3g12270genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.63.6e-32181237158
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                +ep++VNaKQyq+Il+RRq+Rakle+++kl +k rkpylheSRh hAl+R+RgsgGrF
  Tp3g12270 181 NEPIFVNAKQYQAILRRRQHRAKLEAQNKL-IKVRKPYLHESRHLHALKRARGSGGRF 237
                59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.0E-36179240IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.507180240IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.5E-26182237IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.8E-22183205IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860185205IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.8E-22214237IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MQEFHSKDTL SCPATSWGNA VFTNSNVQGS SSSMTDNNTL SLTMEMMSTH FPGMKQTGFQ  60
LQDHDFSSTQ STAGESSGEA AKFGGHNNNR YGRSIVTHLS GYKENAGGPN GSQSKLILSK  120
DSQNSAVLAT IEASWTLHGN ETPHLNGFMS FPYASQHTVQ HPQIGGLMPS RMLLPHNIPE  180
NEPIFVNAKQ YQAILRRRQH RAKLEAQNKL IKVRKPYLHE SRHLHALKRA RGSGGRFLNT  240
KKLQESKSPQ SPPFLALPQF FKNPQGKLRQ RDISGVGIGS SGSATSCSDL TGNNNDMFLQ  300
QNPQFRFSGY PSNHHVSVLM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-18182252372NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp3g12270
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024015185.10.0nuclear transcription factor Y subunit A-6 isoform X3
SwissprotQ9LVJ71e-155NFYA6_ARATH; Nuclear transcription factor Y subunit A-6
TrEMBLV4NPX01e-177V4NPX0_EUTSA; Uncharacterized protein
STRINGXP_006407138.11e-177(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM147331620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.11e-155nuclear factor Y, subunit A6
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]