PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp3g09530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WOX
Protein Properties Length: 193aa    MW: 22538.1 Da    PI: 8.7014
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp3g09530genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox642.1e-202283157
               TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
               ++ R+++t eql++L +lF+   r+p+++++++++++l    +++ ++V++WFqN++a+e++
  Tp3g09530 22 KCGRWNPTVEQLKVLTDLFRAgLRTPTTDQIQKISMELsfygKIESKNVFYWFQNHKARERQ 83
               568*****************99**************************************97 PP

2Wus_type_Homeobox113.69.9e-372285265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ++ RW+Pt eQ+k+L++l+++GlrtP++++iq+i++eL+ yGkie+kNVfyWFQN+kaRerqk+
          Tp3g09530 22 KCGRWNPTVEQLKVLTDLFRAGLRTPTTDQIQKISMELSFYGKIESKNVFYWFQNHKARERQKR 85
                       678***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.6251984IPR001356Homeobox domain
SMARTSM003894.7E-42188IPR001356Homeobox domain
PfamPF000461.9E-172383IPR001356Homeobox domain
SuperFamilySSF466893.46E-112487IPR009057Homeodomain-like
CDDcd000866.09E-42585No hitNo description
Gene3DG3DSA:1.10.10.609.8E-82583IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010078Biological Processmaintenance of root meristem identity
GO:1902459Biological Processpositive regulation of stem cell population maintenance
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MSSPVKARSL RGNNGGGGTG TKCGRWNPTV EQLKVLTDLF RAGLRTPTTD QIQKISMELS  60
FYGKIESKNV FYWFQNHKAR ERQKRRKIST DVDHHQENDH IPHHHHHHHL QPSTRDVFEI  120
NEDDEERVME TLQLFPVNSF EDSKVEKMRS RGNNNKYREY IRETNTTTTF PSYSSCGAEM  180
EHPSPLDLRL SFL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013640167.11e-109PREDICTED: WUSCHEL-related homeobox 5
SwissprotQ8H1D21e-105WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBLA0A078EIN41e-109A0A078EIN4_BRANA; BnaC05g41930D protein
STRINGAT3G11260.11e-102(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40142857
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.16e-95WUSCHEL related homeobox 5