PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp3g04740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 295aa    MW: 34204.5 Da    PI: 5.0579
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp3g04740genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF27.83.2e-091150342
               --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
     SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
               i++++ r+ tf  R+  ++K    L +LCd++++ +i+ +
  Tp3g04740 11 ISDDTARKATFNHRKRELMKRLDDLKILCDVDACAVIYNP 50
               99********************************999965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.9E-11160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.666149IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-18185IPR002100Transcription factor, MADS-box
CDDcd002661.09E-22285No hitNo description
PfamPF003199.3E-121150IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MAKKKLNLTY ISDDTARKAT FNHRKRELMK RLDDLKILCD VDACAVIYNP FNSNPEVWPS  60
NLEVYNILQK FEMLTEMDKT YKSVNHKEFL IQNIAKVEKQ NKKLIADNNE KFMRELMFAC  120
LGQNMGDLHM NDNIRLNLCE FIDQYLKNLL NHENVTLNNP HFEIGESSSM AMVVDMAPTD  180
MADAGSSSFW NASIFNSTQL TNESHAPILN SHQLTNEMQP MISSNQGSEH VGSLASSLLP  240
ISDHEVNTPV INQDEVYYPN QNQNQNQQDW YVEEMMKHSE QTGFPWMEEN HHYKF
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp3g04740
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180438.21e-114AGAMOUS-like 46
TrEMBLA0A178VYD31e-113A0A178VYD3_ARATH; AGL46
TrEMBLF4IIT61e-113F4IIT6_ARATH; AGAMOUS-like 46
TrEMBLQ7XJ971e-113Q7XJ97_ARATH; Uncharacterized protein
STRINGAT2G28700.11e-114(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28700.11e-112AGAMOUS-like 46