PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp3g04730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 245aa    MW: 28592.4 Da    PI: 9.7932
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp3g04730genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.14.2e-171150342
               --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
     SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
               i n+s r+ tf+kR+ g +KK +ELSvLC+++++ +i+s+
  Tp3g04730 11 ITNDSMRKSTFAKRKRGFFKKIHELSVLCGIKACAVIYSP 50
               89************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.3E-22160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.03149IPR002100Transcription factor, MADS-box
CDDcd002663.63E-34285No hitNo description
SuperFamilySSF554557.59E-24294IPR002100Transcription factor, MADS-box
PRINTSPR004048.8E-8323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-151150IPR002100Transcription factor, MADS-box
PRINTSPR004048.8E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MTRKKLNLAY ITNDSMRKST FAKRKRGFFK KIHELSVLCG IKACAVIYSP FSSNPEVWPS  60
NSGVRNVVEK FENVAEMEQE KKMVNHEGFL RQSIIKTMEN NNKKMKDNKE RTMKEAMFQI  120
LAGKGGNFKL TGRNREDLCN YIDHYLKELH HHRNQILNQS HLEYGESSSA ANVMSPSSAI  180
AERSNLNVNH NQYEQKFGGY PIVAQDGLYN PNQQENWLVN QMMNHPHQMR FAMMDDNNRY  240
YHHQS
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp3g04730
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024015652.11e-127agamous-like MADS-box protein AGL80 isoform X2
TrEMBLA0A078GME91e-116A0A078GME9_BRANA; BnaA05g31440D protein
STRINGAT3G05860.11e-113(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.31e-101M-type_MADS family protein