PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp3g00140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WRKY
Protein Properties Length: 151aa    MW: 17394.4 Da    PI: 9.1931
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp3g00140genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1031.6e-3272130159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK vk+++fprsYY+Ct++gC+vkk+v+r + d+ vv++tY+g H+h+
  Tp3g00140  72 LDDGYRWRKYGQKAVKNNPFPRSYYKCTQEGCRVKKQVQRLSGDEGVVVTTYQGVHTHP 130
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.5E-3457130IPR003657WRKY domain
SuperFamilySSF1182902.62E-2964131IPR003657WRKY domain
PROSITE profilePS5081130.72267132IPR003657WRKY domain
SMARTSM007748.5E-3872131IPR003657WRKY domain
PfamPF031062.4E-2673130IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006817Biological Processphosphate ion transport
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MEDRCQVLFP CSSSSSADHR LSGEQTQSAS QTNTSSSSHH STKEEEKVKS EKKMKEREPK  60
FAFQTRSQVD ILDDGYRWRK YGQKAVKNNP FPRSYYKCTQ EGCRVKKQVQ RLSGDEGVVV  120
TTYQGVHTHP VDKPSDNFHH ILTQMHIFPP F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-2962129774Probable WRKY transcription factor 4
2lex_A8e-2962129774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00325DAPTransfer from AT3G01970Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC2465801e-124KC246580.1 Brassica napus WRKY transcription factor 45.1 (WRKY45.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006300107.12e-80hypothetical protein CARUB_v10016335mg
SwissprotQ9S7637e-69WRK45_ARATH; Probable WRKY transcription factor 45
TrEMBLA0A087H6A01e-85A0A087H6A0_ARAAL; Uncharacterized protein
STRINGBra040557.1-P2e-75(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01970.11e-66WRKY DNA-binding protein 45