PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g30370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family SRS
Protein Properties Length: 342aa    MW: 36255.8 Da    PI: 7.6978
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g30370genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702219.85.9e-681282743154
     DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkelet 102
                sg+ sCqdCGnqakkdCah+RCRtCCksrg++C thvkstWvpaakrre qqql + ++ +     e+ +kr+re+  +++++l +t++++++++  le+
  Tp2g30370 128 SGGPSCQDCGNQAKKDCAHMRCRTCCKSRGLECPTHVKSTWVPAAKRRECQQQLGSGQQPQ----GESVPKRQREQFPARSTSLVCTRIPTHNTS-GLEI 222
                68889*************************************************9987766....67899*********************9876.99** PP

     DUF702 103 sslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                 ++P+evss+a frcvrvssv+dge+e+aY+tavsigGh+fkGiLydqG++e
  Tp2g30370 223 GNFPAEVSSAANFRCVRVSSVEDGEDEYAYKTAVSIGGHIFKGILYDQGPAE 274
                *************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051429.9E-61130273IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016233.1E-27132174IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016246.0E-27225272IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MAGFFSLGNG GGGADGGGSS HDEHHHHNRP NTNNNNPSPS GTESWLWCRN PNPNANAGGG  60
DLAPSYKGTL ELWQHPSNQE MLFQQQQQRL DLYTSAAGLG VGPSHRSLIE ASGGGPAGLM  120
MMRSTGGSGG PSCQDCGNQA KKDCAHMRCR TCCKSRGLEC PTHVKSTWVP AAKRRECQQQ  180
LGSGQQPQGE SVPKRQREQF PARSTSLVCT RIPTHNTSGL EIGNFPAEVS SAANFRCVRV  240
SSVEDGEDEY AYKTAVSIGG HIFKGILYDQ GPAERSSSWG GSQPLNLITA GPSASSSSPN  300
MSCNNGVVGS TSDHYVDPAS VNYPTPVNSF MTGTHFFSNP RS
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Suppressor of the gibberellin (GA) signal transduction. {ECO:0000269|PubMed:10368174, ECO:0000269|PubMed:11706176, ECO:0000269|PubMed:16740146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp2g30370
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM2229250.0HM222925.1 Thellungiella parvula folic acid transporter gene, complete cds; glutaredoxin gene, complete sequence; kinesin motor family protein, NAC105, zinc finger CCCH-type protein, phosphatidic acid phosphatase, pentatricopeptide repeat protein, GTP binding protein, GAMMA CA3/carbonate dehydratase, and pentatricopeptide repeat genes, complete cds; and unknown genes.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006393825.10.0protein SHORT INTERNODES
SwissprotQ9XGX00.0SHI_ARATH; Protein SHORT INTERNODES
TrEMBLE5F7210.0E5F721_9BRAS; Uncharacterized protein
STRINGXP_006393825.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34192864
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.11e-149Lateral root primordium (LRP) protein-related
Publications ? help Back to Top
  1. Oh DH, et al.
    Genome structures and halophyte-specific gene expression of the extremophile Thellungiella parvula in comparison with Thellungiella salsuginea (Thellungiella halophila) and Arabidopsis.
    Plant Physiol., 2010. 154(3): p. 1040-52
    [PMID:20833729]
  2. Islam MA, et al.
    Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants.
    PLoS ONE, 2013. 8(1): p. e53377
    [PMID:23308204]
  3. Pfannebecker KC,Lange M,Rupp O,Becker A
    An Evolutionary Framework for Carpel Developmental Control Genes.
    Mol. Biol. Evol., 2017. 34(2): p. 330-348
    [PMID:28049761]
  4. Estornell LH,Landberg K,Cierlik I,Sundberg E
    SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis.
    Front Plant Sci, 2018. 9: p. 150
    [PMID:29491878]