PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g28440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 364aa    MW: 41810.9 Da    PI: 9.2922
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g28440genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF73.41.8e-231160251
               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               +++++s + +++ kR+++++KKA+ELS+LC++ v+vi+++++g+l+++++
  Tp2g28440 11 SSSSHSLAATSLRKRLKTVFKKAYELSILCQIGVCVIYYGPNGELKTWPK 60
               7999********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.5E-4161IPR002100Transcription factor, MADS-box
CDDcd002663.10E-141963No hitNo description
PfamPF003192.2E-132058IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.09E-142095IPR002100Transcription factor, MADS-box
PROSITE profilePS5006610.4422062IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MRASSSSSSS SSSSHSLAAT SLRKRLKTVF KKAYELSILC QIGVCVIYYG PNGELKTWPK  60
EREKVIDLAL RYKAATKRKN SLNLHEFLEE KKEKEKDETN LKKKKKTKKR ESENVKYPDW  120
YPVFDQYSPN QLYQLILSLE RTLSRLQERL RFVEAQKQRN TNLVHQSLTP SSLNMHHHQY  180
QTQPLNPSQF SLYLYSREDA TFSQLPLSAS HSIQPINNQN HSMMQQQGLY GFDHRITNIN  240
FQYPCVSNTQ DHSALLLAQA SGLNNHLMQQ QDLYGSHRNM CTVNDITNSN VLRHPYLSNT  300
VPDEFCSDLQ KSLDGHSVGG TSFFQDFQDL HSANDQSSLL QTSSLPSLHT ISNSYLLPDN  360
SRFL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12127LRKRLKT
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp2g28440
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013674541.11e-128agamous-like MADS-box protein AGL75
TrEMBLA0A3P6DKJ41e-127A0A3P6DKJ4_BRAOL; Uncharacterized protein
STRINGBostr.0568s0255.1.p1e-128(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56620126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65330.11e-111AGAMOUS-like 78