PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g27870
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WRKY
Protein Properties Length: 195aa    MW: 22156.3 Da    PI: 6.1563
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g27870genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY89.52.8e-28110168159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                +dDgy+WrKYG+K+vk++++ r+YY+C+s+gC+vkk+ver+ ed  +v++tYeg Hnhe
  Tp2g27870 110 MDDGYKWRKYGKKSVKNNTNKRNYYKCSSEGCMVKKRVERDGEDAAYVITTYEGVHNHE 168
                59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.8E-3197170IPR003657WRKY domain
SuperFamilySSF1182909.68E-27102170IPR003657WRKY domain
PROSITE profilePS5081129.413105170IPR003657WRKY domain
SMARTSM007743.6E-32110169IPR003657WRKY domain
PfamPF031061.8E-22111168IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MNLSQNPSPN FTFFSDENFI HPFMDNFDFS NLMFDADEGG NKGLIQEETS SPISLVSSET  60
FTGESGGSGN AVTTLSKKES TFDCKSRGSG ETKEMGHRVA FRTRSKIDVM DDGYKWRKYG  120
KKSVKNNTNK RNYYKCSSEG CMVKKRVERD GEDAAYVITT YEGVHNHESP SHVYYNDMVL  180
SYDHDNWNQH SLLQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-24100171778Probable WRKY transcription factor 4
2lex_A3e-24100171778Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0257551e-176BT025755.1 Arabidopsis thaliana At5g64810 mRNA, complete cds.
GenBankAF4262521e-176AF426252.1 Arabidopsis thaliana WRKY transcription factor 51 (WRKY51) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394110.11e-131hypothetical protein EUTSA_v10004930mg
SwissprotQ93WU91e-118WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLV4MJ411e-131V4MJ41_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.8__2513__AT5G64810.11e-116(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57112747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.11e-107WRKY DNA-binding protein 51