PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g25290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family G2-like
Protein Properties Length: 898aa    MW: 97499.1 Da    PI: 4.8591
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g25290genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like58.81.2e-1866118154
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                k++++Wt+ L + F +a++++ G  kAtPk+ile+m++k Lt++h++S LQkYR
  Tp2g25290  66 KKKIKWTTSLQDLFHQAIQHI-GLRKATPKKILEFMNLKYLTRAHIASKLQKYR 118
                6899*****************.9******************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-1964124IPR009057Homeodomain-like
SuperFamilySSF466891.79E-1364123IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-2066119IPR006447Myb domain, plants
SMARTSM007101400301326IPR006626Parallel beta-helix repeat
SMARTSM007101800327376IPR006626Parallel beta-helix repeat
SMARTSM007104200379405IPR006626Parallel beta-helix repeat
SMARTSM007105400408437IPR006626Parallel beta-helix repeat
SMARTSM007106300440469IPR006626Parallel beta-helix repeat
SMARTSM0071084603632IPR006626Parallel beta-helix repeat
SMARTSM00710700659701IPR006626Parallel beta-helix repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 898 aa     Download sequence    Send to blast
MNNEIEQETL PSGAMSFMRQ PVEPNDVNTV WKHALNYKIH DASRKIQKTG SSSNPYDGDS  60
RPQATKKKIK WTTSLQDLFH QAIQHIGLRK ATPKKILEFM NLKYLTRAHI ASKLQKYRKF  120
LKRVKEEGLE RTRKAMNSNF TSSSYINPQH SYNYNTSLHS NNLFNSQPGH GLGQTGPMMN  180
NNAGLHDSVD YMNCKPTYIF SQTGSNLLPR RDSFGFSNGM LPPKEKKRSI FGTSQESHAP  240
RFGKYGKTSD VLGMNSNITT SNMGSNYVGI RKYGYGDSVE RGGSRVYGND NGFGGTRVHG  300
TSNGYLDGIR VHGNGYETFG GTRVHGISNG YLDGIRVHGN GNDSLGGTRV DFNSNGNDSL  360
GGTRVHGDGN GIRVHDDANG NTSLDEVRVY GNNNDNSLGG IRTRGTRNTD GFLDGMVVNG  420
NGDDNGNDSF GGIRVNSVDN GSGSLNGIIV HGSGNSGSNG SFGGIRVHGT NDASVSGIRS  480
HGIGNDNGFL GENLDDMNWN FSNNNIGNHD NVDASGSLGG TADGSVGGMK VHGTGNGNGS  540
PDEILGGMNW NFNNSNTNNH GNSDGNDSIG GIRVHGTDDS FVGGIRLQGI GNDNESFSKN  600
LDGLNLIFSN NNMSNQGNGD DNGSLGGIRV HGTTDGSFGG IRVHGADNAN GYLGENLDVM  660
NWSFSNNNMS NHGNSNDNDF FGGIKLHGTD DDYVDGIRVH DTSYPSGSFG ENLDDMKWNF  720
DNNNISNHES STSGFPSTLS SFVNNKEQSQ NDLINQAGGV VHVQEDPNKS NDYHIINEAF  780
CDVTNLQFDQ NQHQDNMNDE NLEVSTAYPL EDIDNWSFNN DDYNEEILNS LAANPEMYFP  840
NQDMNITNEE NGVADLTEFP LSIVQENDVA DLTELPLSTI QDSDDEDFMK YLVDPDMS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013617959.10.0PREDICTED: filaggrin-2-like
TrEMBLA0A078DCG81e-150A0A078DCG8_BRANA; BnaC03g51950D protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1654279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62110.14e-32G2-like family protein