PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g22310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family TALE
Protein Properties Length: 434aa    MW: 47888.2 Da    PI: 6.3662
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g22310genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.41e-073714042154
                HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                k +yp++e++++L +++gL+ +q+ +WF N+R +
  Tp2g22310 371 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 404
                469*****************************87 PP

2ELK28.82.8e-10325346122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELKh+L+++Y+++++++++E++
  Tp2g22310 325 ELKHELKQGYKEKIVDIREEIL 346
                9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.6E-19161205IPR005540KNOX1
PfamPF037901.2E-17164204IPR005540KNOX1
SMARTSM012562.0E-29216271IPR005541KNOX2
PfamPF037912.8E-21220270IPR005541KNOX2
PfamPF037891.0E-6325346IPR005539ELK domain
PROSITE profilePS512139.969325345IPR005539ELK domain
SMARTSM011886.1E-4325346IPR005539ELK domain
PROSITE profilePS5007111.726345408IPR001356Homeobox domain
SMARTSM003892.4E-11347412IPR001356Homeobox domain
SuperFamilySSF466895.13E-16347411IPR009057Homeodomain-like
CDDcd000868.17E-12348409No hitNo description
Gene3DG3DSA:1.10.10.603.7E-25352409IPR009057Homeodomain-like
PfamPF059201.2E-17365404IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MAFHHNHLSQ DLSFNHFTDQ HQPPPPQPPP PQQQQQQQQH FQEAAPPNWL NTALLRSDNN  60
FLNLHTATAN TTAASSSDSP SSAAAAAANQ WLSRSSSSFL QRTGSNNNNA AAASGAAVVG  120
DVIEDVTGGG EPMIGGDMKS GENKNDRGGA AAEGVVSWQN ARHKAEILSH PLYEQLLSAH  180
VACLRIATPV DQLPRIDAQL AQSQHVVAKY SALGAGQGLV GDDKELDQFM THYVLLLCSF  240
KEQLQQHVRV HAMEAVMACW EIEQSLQSLT GVSPGEGMGA TMSDDEDEQV ESDANMFDGG  300
LDVLGFGPLI PTESERSLME RVRQELKHEL KQGYKEKIVD IREEILRKRR AGKLPGDTTS  360
VLKAWWQSHS KWPYPTEEDK ARLVQETGLQ LKQINNWFIN QRKRNWHSNP SSSTVLKNKR  420
KSNAGDNSGR ERFT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12348412872Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3529660.0AK352966.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-12-H10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394770.10.0hypothetical protein EUTSA_v10004250mg
SwissprotP480000.0KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLE4MWR90.0E4MWR9_EUTHA; mRNA, clone: RTFL01-12-H10
TrEMBLV4MKY20.0V4MKY2_EUTSA; Uncharacterized protein
STRINGAT5G25220.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44428158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.10.0KNOTTED1-like homeobox gene 3