PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g21290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 358aa    MW: 41426.7 Da    PI: 6.6585
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g21290genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF473.2e-151151343
               --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
     SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
               i nk+ r++tf kR+ g +KK +EL +LC+++++ +i+s++
  Tp2g21290 11 IANKTSRKTTFKKRKRGFMKKLNELATLCGVKACGVIYSPD 51
               89*************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-19160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.498149IPR002100Transcription factor, MADS-box
CDDcd002667.91E-30283No hitNo description
SuperFamilySSF554552.09E-22396IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-8323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-151151IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MARARVKLSL IANKTSRKTT FKKRKRGFMK KLNELATLCG VKACGVIYSP DDVNPEVWPS  60
QEGATEVLSE FMKIPEMERT KKMYDQATYT LERIKKEKEK VTKLHDENRE SELRELMFDI  120
FRKKTMIENH CYDAALIQDL SFFIDHYINE LTHRIEILET NGESAHPTVG DVNHVVAPAT  180
SVTTSIGFYD HILQYQNMNM HMNQHAPPNF NDYIQNQNID HQQFQYQASA NFYDQNQQRF  240
YDLSHDMNMD LNHNQRHIPN QYPNLHQPFM NQLMAQPRQM SFVEELVSIA SMDNHYHQLP  300
ITNHMSFIST TTIPIDTIAT AVTTTTSTTT AITADATTTD LSADSINNNR WPTRIGLN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11631RKTTFKKRKRGFMKKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp2g21290
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009151151.11e-108PREDICTED: MADS-box transcription factor PHERES 2
TrEMBLA0A3P5YK881e-107A0A3P5YK88_BRACM; Uncharacterized protein
STRINGBra009911.1-P1e-108(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26650.11e-54AGAMOUS-like 36