PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g19620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family G2-like
Protein Properties Length: 197aa    MW: 22372.2 Da    PI: 9.3625
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g19620genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like71.11.7e-222275155
    G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
               k r++W +eLH++F++av+++ Gs kA+P tile m+v g+t+e+v+SHLQk+R+
  Tp2g19620 22 KRRVVWDKELHNKFLKAVDEI-GSSKAVPTTILEKMNVGGITRENVASHLQKHRV 75
               689******************.9*******************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.5491978IPR017930Myb domain
SuperFamilySSF466897.53E-162079IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-222079IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-212275IPR006447Myb domain, plants
PfamPF002492.6E-62474IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MALNGKANEV DREHDRDSNT KKRRVVWDKE LHNKFLKAVD EIGSSKAVPT TILEKMNVGG  60
ITRENVASHL QKHRVNLEKE KEKKTIEERN RSLAPPQRGG MYNGGRSNDY NEEVDAISNL  120
ISRFSQNSEM VSLFHLLEPV MATTMLPEPS RLHVPSFPSS LTDISSLNQN KKPVLMVDVT  180
RGFNYNNSYS VHEQQQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-192179462ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009129772.13e-29PREDICTED: putative two-component response regulator-like APRR4
TrEMBLA0A078H5S83e-29A0A078H5S8_BRANA; BnaA02g30670D protein
TrEMBLM4DVV83e-29M4DVV8_BRARP; Uncharacterized protein
STRINGBra020652.1-P9e-29(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15903712
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.24e-20response regulator 1