PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g15030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family G2-like
Protein Properties Length: 358aa    MW: 40377.1 Da    PI: 6.2986
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g15030genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.93.4e-31200255156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k+r++W++ LH+rF++a++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Tp2g15030 200 KQRRCWSQGLHKRFLNALKQLGGPHVATPKQIRELMKVEGLTNDEVKSHLQKYRLH 255
                79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.546197257IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-27198258IPR009057Homeodomain-like
SuperFamilySSF466894.6E-16198258IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-27200255IPR006447Myb domain, plants
PfamPF002494.5E-6202253IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MIKSLSNMKN YNEKRERYCE YIEALEEERR KINVFQRELP LCLELVTQAI EAYKKEISGT  60
TMENLNGQSE CSEQTTGECG PILDLFIPIK HSSVSIEEEE EEVDEDDDEH ESHDTGIDFE  120
DKNMKSEWLK SVQLWNQPDA VISNKSKRSE QEIETVVDAI KGKDNKAVSH QPSCYEMSNG  180
ENINSTKSPA TITDEIGQRK QRRCWSQGLH KRFLNALKQL GGPHVATPKQ IRELMKVEGL  240
TNDEVKSHLQ KYRLHTRRPS QTIPNIGDSQ TQHFVVVGGI WAPQASHSTA NAVASGETTT  300
GIYGPMVSPL SSEWPSHSNF GRTISKERSR CSDKGFIRCS SPAMSSSTRT KTKDAKIS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013705360.10.0PREDICTED: probable transcription factor KAN3
TrEMBLA0A078D5G70.0A0A078D5G7_BRANA; BnaC07g22940D protein
STRINGBra025161.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136001827
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G25790.11e-174G2-like family protein