PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g14060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 324aa    MW: 36758.3 Da    PI: 8.0604
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g14060genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.36.2e-211053245
               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
               + en+  rq tf+kR+ngilKKA+ELS+LCd+++ +++fs++gk
  Tp2g14060 10 KLENTNGRQATFAKRKNGILKKANELSILCDIDIVLLMFSPSGK 53
               6799**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.348153IPR002100Transcription factor, MADS-box
SMARTSM004328.2E-30160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-22171IPR002100Transcription factor, MADS-box
CDDcd001207.86E-25253No hitNo description
PRINTSPR004042.6E-18323IPR002100Transcription factor, MADS-box
PfamPF003195.9E-191154IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGRVKLKIKK LENTNGRQAT FAKRKNGILK KANELSILCD IDIVLLMFSP SGKASLCCGR  60
RRKVENLEEN FPKVGSRCKY TRIYCLEDLS TQVRILQARI SEIHNRLSYW TEPYKINNVD  120
LLGQLEFSIR QSLDQLRAHK LQDGIQIPLE QQLQSMSWIL NSNTSNIVTE EHNSIPQREV  180
ECSASSSFGS YPGYFGTGKS PEITISGQET SFLDELTTTN GHLRLQTNSQ QQFTNNSSIA  240
YNPSLQSDLN HHQTLPPPPH PPVYNFPMNQ REYHMNGFFE APPPESSAYN NNTNQGRFGS  300
SNNSLACSVS MLDEYLFSQM QQPN
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp2g14060
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1412321e-158AY141232.1 Arabidopsis thaliana MADS-box protein AGL30 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002875185.11e-170agamous-like MADS-box protein AGL30 isoform X2
SwissprotQ1PFA41e-162AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLA0A397Z3D71e-169A0A397Z3D7_BRACM; Uncharacterized protein
TrEMBLD7LQC81e-169D7LQC8_ARALL; Predicted protein
STRINGAl_scaffold_0005_2281e-169(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM87542539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.11e-168AGAMOUS-like 30
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]